KEGG   Rattus norvegicus (rat): 25216Help
Entry
25216             CDS       T01003                                 

Gene name
Sdc1, HSPG, SYNDECA, Synd1, Syndecan
Definition
(RefSeq) syndecan 1
  KO
K06257  syndecan 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04512  ECM-receptor interaction
rno04514  Cell adhesion molecules (CAMs)
rno05144  Malaria
rno05205  Proteoglycans in cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    25216 (Sdc1)
   04514 Cell adhesion molecules (CAMs)
    25216 (Sdc1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    25216 (Sdc1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    25216 (Sdc1)
  09174 Infectious disease: parasitic
   05144 Malaria
    25216 (Sdc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25216 (Sdc1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25216 (Sdc1)
   00535 Proteoglycans [BR:rno00535]
    25216 (Sdc1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    25216 (Sdc1)
CD molecules [BR:rno04090]
 Proteins
  25216 (Sdc1)
Proteoglycans [BR:rno00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   25216 (Sdc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syndecan Glycophorin_A Romo1
Motif
Other DBs
NCBI-GeneID: 25216
NCBI-ProteinID: NP_037158
RGD: 3648
Ensembl: ENSRNOG00000059947
UniProt: P26260
Position
6q14
AA seq 313 aa AA seqDB search
MRRAALWLWLCALALRLQPALPQIVTANVPPEDQDGSGDDSDNFSGSGTGALPDMTLSRQ
TPSTWKDVWLLTATPTAPEPTSRDTEATLTSILPAGEKPEEGEPVAHVEAEPDFTARDKE
KEATTRPRETTQLPVTQQASTAARATTAQASVTSHPHGDVQPGLHETLAPTAPGQPDHQP
PSVEDGGTSVIKEVVEDETTNQLPAGEGSGEQDFTFETSGENTAVAGVEPDLRNQSPVDE
GATGASQGLLDRKEVLGGVIAGGLVGLIFAVCLVAFMLYRMKKKDEGSYSLEEPKQANGG
AYQKPTKQEEFYA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagacgtgcggcgctctggctttggctctgcgcgctggcgctgcgcctgcagcctgcc
ctcccgcaaattgtcaccgcaaatgtgcctcctgaagaccaagatggctctggggacgac
tcagacaacttctctggctcaggcacaggtgctttgccagatatgactttgtcacggcag
acaccttccacttggaaggatgtgtggctcctgacagctacacccacagctccagaaccc
accagcagggataccgaggccaccctcacctctatcctgccggctggagagaagcctgag
gagggagagcccgtggcccacgtggaagcagagcctgacttcactgctcgggacaaggag
aaggaggccaccaccaggcctagggagaccacacagctcccagtcacccaacaggcctca
acagcagccagagccaccacggcccaggcatctgtcacgtctcatccccacggggatgtg
caacctggcctccacgagaccttggctcccacagcacccggccaacctgaccatcagcct
ccaagtgtggaggatggaggcacttctgtcatcaaagaggttgtggaggatgaaactacc
aatcagcttcctgcaggagagggctctggagaacaagacttcacctttgaaacatctggg
gagaacacagctgtggctggcgtcgagcctgaccttcggaatcagtccccagtggatgaa
ggagccacaggtgcttctcagggccttttggacaggaaggaagtgctgggaggtgtcatt
gctggaggcctggtgggcctcatctttgctgtgtgcctggtggctttcatgctataccgg
atgaagaagaaggacgaaggcagttactccttggaggagcccaaacaagccaatggcggt
gcctaccagaaacccaccaagcaggaagagttctacgcctga

DBGET integrated database retrieval system