KEGG   Rattus norvegicus (rat): 25221
Entry
25221             CDS       T01003                                 

Gene name
Sry, SRYGENE, Sry1, Sry3BI, Tdf, Tdy
Definition
(RefSeq) sex determining region Y
  KO
K09266  sex-determining region Y protein (SOX group A)
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25221 (Sry)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    25221 (Sry)
SSDB
Motif
Pfam: HMG_box HMG_box_2 HTH_24
Other DBs
NCBI-GeneID: 25221
NCBI-ProteinID: NP_036904
RGD: 3759
Ensembl: ENSRNOG00000062090
Vega: OTTRNOG00000002365
UniProt: Q9ERV8
Position
Yq11
AA seq 169 aa
MEGHVKRPMNAFMVWSRGERRKLAQQNPSMQNSEISKHLGYQWKSLTEAEKRPFFQEAQR
LKTLHREKYPNYKYQPHRRVKVPQRSYTLQREVASTKLYNLLQWDNNLHTIIYGQDWARA
AHQSSKNQKSIYLQPVDIPTGYPLQQKQQHQQQQHVHLQQQQQQQHQFH
NT seq 510 nt   +upstreamnt  +downstreamnt
atggagggccatgtcaagcgccccatgaatgcatttatggtgtggtcccgtggagagagg
cgcaagttggctcaacagaatcccagcatgcagaattcagagatcagcaagcatctggga
tatcagtggaaaagccttacagaagccgaaaaaaggccctttttccaggaggcgcagaga
ctgaagaccctacacagagagaaatatccaaactataaatatcagcctcatcgaagggtt
aaagtgccacagaggagttatactttgcagcgtgaagttgcctcaacaaaactgtacaac
ctgctgcaatgggacaacaacctacacactatcatatacggacaggactgggctagagct
gcacaccagtcctccaagaaccagaaaagcatttatttacagcctgtggacatccccact
ggatacccactacagcagaaacagcagcaccagcagcagcagcacgtgcacctgcagcag
cagcagcagcagcagcaccagttccactag

DBGET integrated database retrieval system