KEGG   Rattus norvegicus (rat): 25227Help
Entry
25227             CDS       T01003                                 

Gene name
Arsb
Definition
(RefSeq) arylsulfatase B
  KO
K01135  arylsulfatase B [EC:3.1.6.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00531  Glycosaminoglycan degradation
rno01100  Metabolic pathways
rno04142  Lysosome
Module
rno_M00076  Dermatan sulfate degradation
rno_M00077  Chondroitin sulfate degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    25227 (Arsb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    25227 (Arsb)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.12  N-acetylgalactosamine-4-sulfatase
     25227 (Arsb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfatase Phosphodiest Sulfatase_C DUF4994 DUF1501 DnaB
Motif
Other DBs
NCBI-GeneID: 25227
NCBI-ProteinID: NP_254278
RGD: 2158
Ensembl: ENSRNOG00000011150
UniProt: P50430 B4F7E2
Position
2q12
AA seq 528 aa AA seqDB search
MGELSGCTGGSRAGGPGPRLPLLLLLLLWPARASDAAPPPHVVFVLADDLGWNDLGFHGS
VIRTPHLDALAAGGVVLDNYYVQPLCTPSRSQLLTGRYQIHMGLQHYLIMTCQPNCVPLD
EKLLPQLLKDAGYATHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYTHEACAPIE
CLNGTRCALDLRDGEEPAKEYTDIYSTNIFTKRATTLIANHPPEKPLFLYLAFQSVHDPL
QVPEEYMEPYDFIQDKHRRIYAGMVSLLDEAVGNVTKALKSRGLWNNTVLIFSTDNGGQT
RSGGNNWPLRGRKGTLWEGGIRGAGFVASPLLKQKGVKSRELMHITDWLPTLVNLAGGST
HGTKPLDGFDVWETISEGSPSPRVELLLNIDPDFFDGLPCPGKNTTPEKNDSFPLEHSAF
NTSIHAGIRYKNWKLLTGYPGCGYWFPPPSQSNISEVPSVDSPTKTLWLFDINRDPEERH
DVSREHPHIVQNLLSRLQYYHEHSVPSYFPPLDPRCDPKGTGVWSPWM
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagctgagcggatgcaccggcgggagccgagctggaggtccggggccgcggctg
ccactgttgctgctgctgctgctgtggcccgcccgggcctccgacgccgccccgccgccc
catgtggtcttcgtgctggcggacgacctgggctggaacgacttgggtttccacggctcg
gtcatccgcacgccgcacctggatgcgctggcggccggcggcgtggtcctggacaactac
tacgtgcagccgctgtgcacgccctcgcggagccagctgctcaccggccgctatcagatc
catatgggcttacagcattacctcatcatgacctgtcagcccaactgtgttccgctagac
gaaaaactcctgccccagcttttaaaggacgcaggctatgctacgcatatggtcggaaaa
tggcacctgggaatgtaccggaaggaatgcctgccaacccgcagaggattcgatacgtac
ttcggatacctcctaggcagtgaagactactacacccacgaggcctgtgcaccgattgag
tgtctgaacggtacccgctgtgcgcttgatctccgagatggcgaagaacctgcaaaagag
tatacagatatttactcaacaaacatatttaccaaaagggctacaaccctcatagctaac
cacccccccgagaaaccactgttcctctaccttgctttccagtctgtccacgatcccctg
caggtccccgaggagtacatggagccatatgacttcatccaagacaagcacagacgtatt
tatgcagggatggtatccctcctggacgaagcagtggggaatgtcaccaaagccttgaaa
agccgagggctctggaacaacacggtcctcatcttctccacagacaacggcgggcagact
aggtctggaggcaacaactggccacttcgaggaaggaaagggaccctgtgggaaggtggc
atccgaggagcaggtttcgtggcaagccccttgctgaaacagaaaggtgtgaagagccgg
gagctcatgcacatcaccgattggcttccaacgctggtgaatctggctgggggaagcacc
catggaaccaaacctctggatggcttcgacgtgtgggaaacaatcagtgaaggaagccca
tccccaagagtggagctgctacttaacatcgatccagactttttcgatggcttaccatgt
cctggcaagaacacgactccagaaaagaacgattcttttcctttagaacattctgccttt
aacacatctatccatgctgggatcagatacaaaaactggaaactcctcacgggctaccca
ggctgtggttactggttcccgccaccgtctcagtccaacatctctgaggtaccttcagtg
gactcaccaaccaagactctctggctctttgacatcaatcgggaccctgaagaaagacat
gacgtgtcccgggaacatccccacatcgtccagaaccttctttcccgcctacagtactac
catgaacattctgtgccttcttacttcccacctttggacccccgctgtgatcccaagggt
accggtgtatggagcccctggatgtag

DBGET integrated database retrieval system