KEGG   Rattus norvegicus (rat): 25227
Entry
25227             CDS       T01003                                 

Gene name
Arsb
Definition
(RefSeq) arylsulfatase B precursor
  KO
K01135  arylsulfatase B [EC:3.1.6.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00531  Glycosaminoglycan degradation
rno01100  Metabolic pathways
rno04142  Lysosome
Module
rno_M00076  Dermatan sulfate degradation
rno_M00077  Chondroitin sulfate degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    25227 (Arsb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    25227 (Arsb)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.12  N-acetylgalactosamine-4-sulfatase
     25227 (Arsb)
SSDB
Motif
Pfam: Sulfatase Phosphodiest Sulfatase_C DUF4994 DUF1501 DnaB
Other DBs
NCBI-GeneID: 25227
NCBI-ProteinID: NP_254278
RGD: 2158
Ensembl: ENSRNOG00000011150
UniProt: P50430 B4F7E2
Position
2
AA seq 528 aa
MGELSGCTGGSRAGGPGPRLPLLLLLLLWPARASDAAPPPHVVFVLADDLGWNDLGFHGS
VIRTPHLDALAAGGVVLDNYYVQPLCTPSRSQLLTGRYQIHMGLQHYLIMTCQPNCVPLD
EKLLPQLLKDAGYATHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYTHEACAPIE
CLNGTRCALDLRDGEEPAKEYTDIYSTNIFTKRATTLIANHPPEKPLFLYLAFQSVHDPL
QVPEEYMEPYDFIQDKHRRIYAGMVSLLDEAVGNVTKALKSRGLWNNTVLIFSTDNGGQT
RSGGNNWPLRGRKGTLWEGGIRGAGFVASPLLKQKGVKSRELMHITDWLPTLVNLAGGST
HGTKPLDGFDVWETISEGSPSPRVELLLNIDPDFFDGLPCPGKNTTPEKNDSFPLEHSAF
NTSIHAGIRYKNWKLLTGYPGCGYWFPPPSQSNISEVPSVDSPTKTLWLFDINRDPEERH
DVSREHPHIVQNLLSRLQYYHEHSVPSYFPPLDPRCDPKGTGVWSPWM
NT seq 1587 nt   +upstreamnt  +downstreamnt
atgggcgagctgagcggatgcaccggcgggagccgagctggaggtccggggccgcggctg
ccactgttgctgctgctgctgctgtggcccgcccgggcctccgacgccgccccgccgccc
catgtggtcttcgtgctggcggacgacctgggctggaacgacttgggtttccacggctcg
gtcatccgcacgccgcacctggatgcgctggcggccggcggcgtggtcctggacaactac
tacgtgcagccgctgtgcacgccctcgcggagccagctgctcaccggccgctatcagatc
catatgggcttacagcattacctcatcatgacctgtcagcccaactgtgttccgctagac
gaaaaactcctgccccagcttttaaaggacgcaggctatgctacgcatatggtcggaaaa
tggcacctgggaatgtaccggaaggaatgcctgccaacccgcagaggattcgatacgtac
ttcggatacctcctaggcagtgaagactactacacccacgaggcctgtgcaccgattgag
tgtctgaacggtacccgctgtgcgcttgatctccgagatggcgaagaacctgcaaaagag
tatacagatatttactcaacaaacatatttaccaaaagggctacaaccctcatagctaac
cacccccccgagaaaccactgttcctctaccttgctttccagtctgtccacgatcccctg
caggtccccgaggagtacatggagccatatgacttcatccaagacaagcacagacgtatt
tatgcagggatggtatccctcctggacgaagcagtggggaatgtcaccaaagccttgaaa
agccgagggctctggaacaacacggtcctcatcttctccacagacaacggcgggcagact
aggtctggaggcaacaactggccacttcgaggaaggaaagggaccctgtgggaaggtggc
atccgaggagcaggtttcgtggcaagccccttgctgaaacagaaaggtgtgaagagccgg
gagctcatgcacatcaccgattggcttccaacgctggtgaatctggctgggggaagcacc
catggaaccaaacctctggatggcttcgacgtgtgggaaacaatcagtgaaggaagccca
tccccaagagtggagctgctacttaacatcgatccagactttttcgatggcttaccatgt
cctggcaagaacacgactccagaaaagaacgattcttttcctttagaacattctgccttt
aacacatctatccatgctgggatcagatacaaaaactggaaactcctcacgggctaccca
ggctgtggttactggttcccgccaccgtctcagtccaacatctctgaggtaccttcagtg
gactcaccaaccaagactctctggctctttgacatcaatcgggaccctgaagaaagacat
gacgtgtcccgggaacatccccacatcgtccagaaccttctttcccgcctacagtactac
catgaacattctgtgccttcttacttcccacctttggacccccgctgtgatcccaagggt
accggtgtatggagcccctggatgtag

KEGG   Rattus norvegicus (rat): 303631
Entry
303631            CDS       T01003                                 

Gene name
Arsg
Definition
(RefSeq) arylsulfatase G precursor
  KO
K12381  arylsulfatase G [EC:3.1.6.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    303631 (Arsg)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.-  
     303631 (Arsg)
SSDB
Motif
Pfam: Sulfatase Sulfatase_C
Other DBs
NCBI-GeneID: 303631
NCBI-ProteinID: NP_001041342
RGD: 1306571
Ensembl: ENSRNOG00000003931
UniProt: Q32KJ9
Position
10
AA seq 526 aa
MGWLFLKVLLVGMVFSGLLYPFVDFSISGETRAPRPNIVIILADDMGWGDLGANWAETKD
TTNLDKMASEGMRFVDFHAAASTCSPSRASLLTGRLGLRNGVTHNFAVTSVGGLPLNETT
LAEVLQQAGYVTAMIGKWHLGHHGSYHPSFRGFDYYFGIPYSNDMGCTDNPGYNYPPCPA
CPQSDGRWRNPDRDCYTDVALPLYENLNIVEQPVNLSGLAQKYAERAVEFIEQASTSGRP
FLLYVGLAHMHVPLSVTPPLANPQSQRLYRASLQEMDSLVGQIKDKVDHVAKENTLLWFA
GDNGPWAQKCELAGSMGPFSGLWQTHQGGSPAKQTTWEGGHRVPALAYWPGRVPVNVTST
ALLSLLDIFPTVIALAGASLPPNRKFDGVDVSEVLFGKSQTGHRVLFHPNSGAAGEYGAL
QTVRLDRYKAFYITGGAKACDGGVGPEQHHVSPLIFNLEDDAAESSPLQKGSPEYQELLP
KVTRVLADVLQDIADDNSSQADYTQDPSVTPCCNPYQITCRCQPGE
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgggctggctctttctaaaggttttgttggttggcatggttttttctggacttctctac
ccgttcgtggatttctctatcagtggggaaacaagagcccccagaccaaacattgtgatc
attttggctgatgacatgggatggggtgatctgggagcaaactgggcagaaacaaaggat
accaccaatcttgacaaaatggcttctgaaggaatgaggtttgtagacttccacgcagct
gcttctacctgctcgccgtcccgagcctccctgcttaccggccggctgggtctacggaat
ggagtcacgcacaactttgcagtcacctctgtaggggggcttccactcaacgagaccacc
ttggcagaggtgctgcagcaggccggttacgtcactgccatgataggcaagtggcatctt
gggcatcatggctcttatcaccccagtttccgtggcttcgattactactttggtatcccg
tatagcaacgacatgggctgtaccgacaaccccggctacaactaccctccttgcccagca
tgtccgcaaagcgatggccgatggaggaaccctgacagggactgttacacagatgtggcc
cttcctctctatgaaaacctgaacatcgtagagcagccggtgaacctgagcggccttgca
cagaagtatgcagagagggcagtggagttcattgagcaggcaagcaccagtgggagaccc
ttcctgctctatgtgggcctggcccacatgcacgtgcctttgtctgtaactccaccgttg
gccaacccacagagccaaaggctgtaccgtgcaagtctccaagagatggacagtctggta
gggcagatcaaggacaaagtggaccacgtggcaaaagaaaacacactcctctggtttgca
ggagacaacggcccgtgggctcagaagtgcgagctggcaggcagcatgggccccttctcc
ggattgtggcaaacccatcaagggggaagtccagccaagcagaccacctgggaaggtggg
catcgggtcccagcactggcttactggcctggcagagttccagtcaatgttaccagcact
gccttgttaagcttgcttgacatcttccccaccgtgatagccctggcgggagccagcttg
cccccaaaccggaagtttgatggtgtggacgtctctgaagtgctctttggcaagtcacaa
acggggcacagggtactgttccaccccaacagtggggctgctggagagtacggcgccctg
cagactgtccgcctggaccgttacaaggccttctacataacgggtggagccaaagcttgt
gatgggggcgtgggtcccgagcagcaccacgtctcccctctcattttcaacctagaagat
gatgctgctgaaagttcccctctacagaagggaagccccgagtaccaggagctgctgccg
aaggtcaccagggttcttgcagatgtccttcaagacatcgctgatgacaacagctctcaa
gcagactacactcaggatccttccgtgaccccttgctgtaacccttatcaaattacctgc
cgttgccaacccggggaatga

KEGG   Rattus norvegicus (rat): 315222
Entry
315222            CDS       T01003                                 

Gene name
Arsa
Definition
(RefSeq) arylsulfatase A precursor
  KO
K01134  arylsulfatase A [EC:3.1.6.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    315222 (Arsa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    315222 (Arsa)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.8  cerebroside-sulfatase
     315222 (Arsa)
SSDB
Motif
Pfam: Sulfatase Sulfatase_C Phosphodiest DUF1501
Other DBs
NCBI-GeneID: 315222
NCBI-ProteinID: NP_001030105
RGD: 1310381
Ensembl: ENSRNOG00000012953
UniProt: Q32KK2
Position
7
AA seq 507 aa
MGALGTLVLALAAGLSTASPPNIMLIFADDLGYGDLGSYGHPSSTTPNLDQLAAGGLRFT
DFYVPVSLCTPSRAALLTGRLPVRSGMYPGVLGPSSQGGLPLEEVTLAEVLAARGYLTGM
AGKWHLGVGPEGAFLPPHQGFHRFLGIPYSHDQGPCQNLTCFPPDITCSGGCDQGLVPIP
LLANLTVEAQPPWLPGLEARYVSFSRDLMADAQRQGRPFFLYYASHHTHYPQFSGQSFTK
RSGRGPFGDSLMELDGAVGALMTAVGDLGLLGETLVIFTADNGPELMRMSDGGCSGLLRC
GKGTTFEGGVREPALVYWPGHITPGVTHELASSLDLLPTLAALTGAPLPNITLDGVDISP
LLLGTGKSPRNSVFFYPPFPDEIHGVFAVRNGKYKAHFFTQGSAHSDTTPDPACHAANRL
TAHEPPLLYDLSKDPGENYNLLDSTEEVSPEALQALKHIELLKAEYDAAMTFSPSQIAKG
EDPALQICCQPSCTPHPVCCHCPDSHS
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgggggccctggggaccctcgttttggcattggctgcaggcctgagcactgctagccca
cctaacatcatgctgatctttgctgatgacctgggctatggggacctcggctcctatggg
caccccagttctaccacccccaacttggatcagttggctgcagggggactacggttcaca
gatttctatgtgcctgtgtctctgtgcactccgtctcgggctgccctcctgactggccgg
ctcccagttcgatcaggcatgtaccctggagttctggggcccagttcccaagggggcctg
cccttggaggaggtgacgttggccgaagtcctggctgctcgaggctatctaacagggatg
gctggcaagtggcatcttggagtagggccagagggggccttcctgcccccacatcagggc
ttccatcgattcctgggcatcccatattcccatgaccagggtccctgtcagaacctgacc
tgcttcccaccagacatcacctgcagtggtggctgtgaccaaggcctagttcccatccca
ctgctggccaacctgactgtggaggcccagcccccttggctgcctggactagaggcccgg
tatgtgtctttctcccgagacctcatggcggatgcccagcgccagggccgaccattcttc
ctgtactacgcttcccaccacacccactaccctcagttcagtggacagagcttcaccaag
cgctcaggccgtgggccctttggggactccttgatggagctggatggagctgtgggggcc
ttgatgacagctgtgggggacctaggtctgctgggagagacactggtcatcttcactgca
gataacggtcctgaattgatgcgtatgtccgatggcggctgctccggcctcttgagatgt
ggaaaaggaacaacttttgaaggtggcgtccgggaacccgccttggtctactggccaggt
cacattactcctggtgtcacccacgagctggccagctctctggacctgctgcccaccctg
gcagcactgaccggggctccgctgcccaatatcaccttggatggtgttgacatcagcccc
ttgctgctaggcacaggcaagagcccacggaattctgtcttcttctacccaccgttccca
gacgagatccatggagtcttcgcggttcggaatgggaagtacaaggctcatttctttacc
cagggctccgcccacagtgacaccactccagatcctgcctgtcatgccgccaaccgtctg
acagctcacgagcccccactgctctacgacttgtctaaggaccctggtgagaactacaat
cttttggatagtacagaggaggtctctccagaagctctccaggctttgaagcacattgag
ctgctcaaggccgagtatgatgcagctatgaccttcagccccagccagatagccaagggt
gaggaccctgcccttcagatctgctgtcagccgagctgcactccccacccagtctgctgc
cactgcccagactcccactcctga

DBGET integrated database retrieval system