KEGG   Rattus norvegicus (rat): 25229Help
Entry
25229             CDS       T01003                                 

Gene name
Chrm1
Definition
(RefSeq) cholinergic receptor, muscarinic 1
  KO
K04129  muscarinic acetylcholine receptor M1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04725  Cholinergic synapse
rno04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    25229 (Chrm1)
   04024 cAMP signaling pathway
    25229 (Chrm1)
   04151 PI3K-Akt signaling pathway
    25229 (Chrm1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25229 (Chrm1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25229 (Chrm1)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    25229 (Chrm1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25229 (Chrm1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    25229 (Chrm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srbc
Motif
Other DBs
NCBI-GeneID: 25229
NCBI-ProteinID: NP_542951
RGD: 2342
Ensembl: ENSRNOG00000018385
UniProt: P08482
Position
1q43
AA seq 460 aa AA seqDB search
MNTSVPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPESPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDSEAQAPTKQPPKSSPNTVKRPTKKGRDRGGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTVNPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaacacctcagtgccccctgctgtcagtcccaacatcactgtcttggcaccaggaaag
ggtccctggcaggtggccttcatcgggatcaccacaggcctcctgtctctagctacagtg
acaggcaacctactggtactcatctccttcaaggtcaacaccgagctcaagacagtcaac
aactacttcctgctgagcctggcctgtgctgacctcatcattggcaccttctccatgaac
ctctataccacgtacctgctcatgggccactgggctctgggcacactggcctgtgacctc
tggctggccctggactatgtggccagcaacgcctctgtcatgaatcttctgctcatcagc
tttgaccgttacttctcggtgacccgacccctgagctaccgagccaagcgcactccccga
agggcagctctgatgattggcctagcatggctggtttccttcgttctctgggccccagcc
atcctcttctggcaatacctagttggggagcggacagtgctggctgggcagtgctacatc
cagttcctctcccaacccatcatcacttttggcacagccatggccgccttctacctccct
gtcacggtcatgtgtacactgtactggcgcatctaccgggagacagaaaaccgagcccgg
gagctggccgccctgcagggctctgagacaccaggcaaaggtggtggcagcagcagcagc
tcagagaggtcacagccaggggctgaaggctcacccgagtcgcctccaggccgctgctgc
cgctgttgccgggcacccaggctcctgcaggcctacagctggaaggaagaagaagaggag
gatgaaggctccatggagtccctcacatcctccgaaggtgaggagcctggctcagaagtg
gtgatcaagatgcccatggtagattctgaagcacaggcacccaccaagcagcctcccaaa
agctccccaaatacagtcaagaggcccaccaagaaaggccgagaccgaggcggcaagggc
caaaaaccccgagggaaggaacagctggccaagagaaagaccttctcactggtcaaggag
aagaaggcagctcggaccctgagtgccatcctgctggccttcatcctcacctggacacca
tataacatcatggtgctggtatctaccttctgcaaggactgtgttcctgaaaccctgtgg
gagctgggctactggctatgctacgtcaacagcactgtcaaccccatgtgctatgcactg
tgcaacaaagccttccgggacacgttccgcctgctgctgctctgccgctgggacaagagg
cgctggcgcaagatccccaagcgccctggctctgtgcaccgcaccccctcccgccaatgc
taa

DBGET integrated database retrieval system