KEGG   Rattus norvegicus (rat): 25230
Entry
25230             CDS       T01003                                 

Gene name
Add3
Definition
(RefSeq) gamma-adducin isoform 1
  KO
K18622  adducin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    25230 (Add3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     25230 (Add3)
SSDB
Motif
Pfam: Aldolase_II
Other DBs
NCBI-GeneID: 25230
NCBI-ProteinID: NP_001157575
RGD: 2043
Ensembl: ENSRNOG00000012820
UniProt: Q62847 G3V9D7
Position
1
AA seq 705 aa
MSSDTSQAVITTPPPPSMPHKERYFDRINESDPEYLRERNMSPDLRQDFNMMEQRKRVTQ
ILQSPAFREDLECLIQEQMKKGHDPTGLLALQQIADYIMANSFTGFSSPPLSLGMVTPIN
DLPGADTSSYVKGEKLTRCKLASLYRLADLFGWAHLANTYISVRVSKEQDHIIIIPRGLS
FSEATASALVKVNIIGEVVDQGSTNLKIDHSGFSPHAAIYSTRPDVKCVIHIHTLATAAV
SSMKCGILPISQESLILGDVAYYDYQGSLDEEEERIELQKVLGPSCKVLVLRNHGVVALG
ETLEEAFHYIFNVQMACEIQVQAVAGAGGVDNLLILDLQKYKAFTHGVAMTGGGGVNMGS
HQKWKVGEIEFEGLMRTLDNLGYRTGYAYRHPLVREKPRHKSDVEIPATVTAFSFEDDSV
PLSPLKYMAQRQQREKTRWLNSPNTYMKVNVPEESRNGETSPRTKITWMKAEDPSKVSSG
TPIKIEDPNQFVPLNTNPTEVLEKRNKIREQNRYDLKTAGPQSQLLAGIVVDKPPSTMRF
EDDDQGPPAPPNPFSHLMEGELEEYTKTIERKQQGLDDAEQESLSDDAASVSQIQSQTQS
PQSVPERLEENHELFSKSFTSVDVPVIVNGKDEMHDVEDELAQRVSRLTTSTTIENIEIT
IKSPDRTEEVLSPDGSPSKSPSKKKKKFRTPSFLKKNKKKEKVEA
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgagttcagacaccagccaagcggtgatcaccacccctcctcctcccagcatgcctcac
aaagagaggtattttgaccgaatcaatgaaagtgacccagaataccttcgagagaggaac
atgtctcctgatctacggcaggacttcaatatgatggagcagaggaagcgagtcactcag
atcctgcagagtcctgcctttcgggaagacctagagtgcctcatccaagaacagatgaag
aaaggccacgacccgaccggattgctagcgttacagcagatcgccgactacatcatggcc
aactccttcaccggtttttcttcacctcccctgagtcttggcatggtcactcctattaat
gaccttcctggtgcagacacatcctcgtatgtgaagggagagaagctcactcgttgcaaa
ctcgccagcctgtacagactcgcagatctgtttgggtgggcacatctggcaaatacatac
atctcggtacgagtaagtaaggagcaggaccacatcataatcatccccagaggcctctct
ttctctgaagccacagcctctgctctggtgaaggtcaacataataggagaagtggtggac
caggggagtactaatttgaaaattgaccactcaggattcagtccccatgctgcaatctat
tcaacccgtcccgatgtgaagtgtgtgatacacatccacaccctcgctacagcagctgtg
tcttccatgaagtgtgggatccttccaatttcccaagagtctctcatcctgggagatgta
gcctattatgactaccaggggtcgcttgatgaggaggaggaaagaatcgaacttcagaaa
gttctgggtccaagctgtaaggtgctggtcctcaggaaccatggcgtggtagctcttgga
gaaacacttgaggaggctttccactacatcttcaatgtacagatggcctgtgagattcag
gtgcaggctgtagcaggggcagggggagtggacaatcttctcatactggatcttcagaaa
tacaaagctttcacccacggtgttgccatgactggaggaggcggtgtgaatatgggttcc
catcagaagtggaaagttggcgagattgagtttgaagggctcatgagaaccctggacaac
ttgggctacagaacaggctacgcatacaggcatcctctagttcgagagaagcctcggcac
aagagtgacgtggagatcccagcaactgtgactgcattctcctttgaagatgatagtgtg
ccactctctcccctcaagtacatggcacagagacagcagcgtgaaaaaacaagatggctg
aattctccaaatacatacatgaaagtgaatgtgccggaggagtcccggaacggggaaact
agtcccaggaccaaaataacgtggatgaaagcagaggacccctctaaagttagtagtgga
acacctatcaaaattgaagatcccaatcagtttgttcctctaaacacgaacccgactgag
gtgctggagaagagaaataagattcgggaacagaatcgctatgacctgaagacagcaggg
ccacagtctcagctgctggcggggatcgttgtggacaaaccgccttctaccatgcggttt
gaagacgatgatcagggcccaccagcccctcctaacccattcagtcatctcatggaagga
gaacttgaagaatatacgaagacaatcgagagaaagcagcaaggcctggacgacgctgag
caggagtcactgtcagatgatgctgcatctgtttcacaaattcagtctcaaactcagtca
ccgcaaagtgtccctgagagattagaagaaaaccacgagctgttttccaagagcttcacc
tctgtggatgtgcctgtcattgtgaatggcaaggacgagatgcacgatgttgaagacgag
ctcgctcagcgcgtcagcaggctcacgacgagcaccaccatagagaacatcgagatcacc
atcaagtccccagacagaactgaagaggtcctgtcacccgatggctcgccttcaaagtca
ccatccaagaaaaagaagaaattccgcacaccttcttttctcaaaaagaacaaaaaaaag
gagaaagttgaggcctaa

DBGET integrated database retrieval system