KEGG   Rattus norvegicus (rat): 25232Help
Entry
25232             CDS       T01003                                 

Gene name
Tyro3, Brt
Definition
(RefSeq) TYRO3 protein tyrosine kinase
  KO
K05116  TYRO3 protein tyrosine kinase 3 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25232 (Tyro3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     25232 (Tyro3)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  AXL family
   25232 (Tyro3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ig_3 I-set fn3 Ig_2 ig V-set C1-set DUF4229 Ig_4 Kinase-like
Motif
Other DBs
NCBI-GeneID: 25232
NCBI-ProteinID: NP_058788
RGD: 3923
Ensembl: ENSRNOG00000058586
UniProt: P55146
Position
3q35
AA seq 880 aa AA seqDB search
MALRRSMGRPGLRPLLLAGLASLLLPGSAAAGLKLMGAPVKMTVSQGQPVKLNCSVEGMD
DPDIHWMKDGAVVQNASQVSISISEQNWIGLLSLKSAERSDAGLYWCQVKDGEETKISQS
VWLTVEGVPFFTVEPKDLAVPPNVPFQLSCEAVGPPEPVTIFWWRGPTKVGGPASSPSVL
NVTGVTQRTEFSCEAHNIKGLATSRPAIIRLQAPPAAPFNITVTTISSSNASVAWVPGAD
GLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYG
DWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQD
ELMVEGTTANLTDWDPQKDLVLRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV
PVVLGVLTALITAAALALILLRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER
IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVK
MLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGD
LHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVC
VADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQ
TPYAGIENAEIYNYLISGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENIL
GHLSVLSTSQDPLYINIERAGQPAENGSPELPCGEQSSSEAGDGSGMGAIGGIPSDCRYI
FSPGGLAESPGQLEQQPESPLNENQRLLLLQQGLLPHSSC
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaggcggagcatggggcggccggggctccggccgctgctgctggcggggctg
gcctctctgctgctcccagggtccgcggccgcaggcctgaagctcatgggagccccagtg
aagatgacagtgtctcaggggcagccagtgaagcttaactgcagtgtggaagggatggat
gaccctgacatacactggatgaaggatggcgctgtggtccagaatgcaagccaggtgtcc
atctcaataagcgaacagaactggattggcttactcagcctaaagtcagcggagcggtct
gatgccggcctgtactggtgccaggtgaaggatggggaggaaaccaagatctctcagtca
gtatggctcactgttgaaggtgtgccattcttcacggtggaaccaaaagatctggcggtg
ccacccaatgtcccttttcaactgtcttgtgaggctgtgggtccaccagaacccgtaacc
attttctggtggagaggacccactaaggttgggggacctgcttcctctccctctgtttta
aatgtaacaggagtgacccagcgcacagagttttcttgtgaagctcataacataaaaggc
ctggccacttcccgaccagccattattcgccttcaagcaccgcctgcagctcctttcaac
atcacagtaacaacgatctccagcagcaacgctagtgtggcctgggtgccgggtgctgat
ggcttagctctgctgcactcctgtactgtacaggtggcacatgccccaggagaatgggag
gcccttgctgtcgtggttcccgtgccaccctttacttgcttgcttcggaacttggcccct
gccaccaactacagccttagggttcgctgtgccaacgccttgggcccttctccctatggc
gactgggtgccctttcagacaaagggcctagcgccagccagagcccctcagaatttccac
gccattcgtactgactcaggccttatcctggaatgggaagaagtgattcctgaggaccct
ggggaaggccccctgggaccttataagctgtcctgggtccaagaaaatggaacccaggat
gagctgatggtggaaggaactacggccaatctgactgactgggatccccagaaggacctg
gttttgcgtgtgtgtgcctccaatgcaattggtgatgggccctggagtcaaccactggtg
gtgtcttctcatgaccatgcagggaggcagggccctcctcacagccgtacatcctgggtg
cctgtggtcctgggtgtgctcaccgccctgatcacagctgctgccttggccctcatcctg
cttcggaagagacgcaaggagacgcggttcgggcaagcctttgacagtgtcatggcccga
ggggagccagctgtacacttccgggcagcccggtctttcaatcgagaaaggcctgaacgc
attgaagctacattggatagcctgggcatcagcgatgaattgaaggagaagctggaggac
gtcctcatcccagagcagcagttcaccctcggccggatgttgggcaaaggagagtttgga
tcagtgcgggaagcccagctgaagcaggaagatggctcctttgtgaaagtggcagtgaag
atgctgaaagctgacatcattgcctcaagcgacatagaagagttcctgagagaagcagct
tgcatgaaggagtttgaccatccacacgtggccaagcttgttggagtgagcctccggagc
agggctaaaggtcgtctccccattcccatggtcatcctgcccttcatgaagcacggagac
ttgcatgcctttctgctcgcctcccgaattggggagaacccttttaacctgcccctccag
accctcgtccggttcatggtggacattgcctgtggcatggagtacctgagctcccggaac
ttcatccaccgagacctagcagctcggaattgcatgctggcagaggacatgacagtgtgt
gtggctgactttggactctcccggaaaatttatagcggggactattatcgtcagggctgt
gcctccaaactgcctgtcaagtggctggccctggagagcttggctgacaacttgtatact
gtacacagcgatgtgtgggccttcggggtgaccatgtgggagatcatgactcgtgggcag
acgccatatgctggcatcgaaaatgctgagatttacaactacctcatcagcgggaaccgc
ctgaagcagcctccggagtgcatggaggaagtgtatgatctcatgtaccagtgctggagt
gccgacccaaagcagcgcccaagcttcacatgcctgcgaatggaactggagaacattctg
ggccacctatctgttctgtccaccagccaggaccccttgtacatcaacattgagagagct
gggcagcctgctgagaatggcagtcccgagctgccctgtggagagcagtctagcagcgag
gcgggggatggcagtggcatgggggcaataggtggcatccccagtgactgtcggtacatc
ttcagccctggagggttggccgagtcaccagggcagctggagcagcagccagaaagcccc
ctcaacgagaaccagaggcttttgttgttgcagcaagggctactgcctcacagtagctgt
taa

DBGET integrated database retrieval system