KEGG   Rattus norvegicus (rat): 25235Help
Entry
25235             CDS       T01003                                 

Gene name
Ghr, GHR/BP
Definition
(RefSeq) growth hormone receptor
  KO
K05080  growth hormone receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04080  Neuroactive ligand-receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    25235 (Ghr)
   04151 PI3K-Akt signaling pathway
    25235 (Ghr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25235 (Ghr)
   04060 Cytokine-cytokine receptor interaction
    25235 (Ghr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    25235 (Ghr)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  Prolactin receptor family
   25235 (Ghr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GHBP EpoR_lig-bind fn3
Motif
Other DBs
NCBI-GeneID: 25235
NCBI-ProteinID: NP_058790
RGD: 2687
Ensembl: ENSRNOG00000015654
UniProt: P16310
Position
2q16
AA seq 638 aa AA seqDB search
MDLWRVFLTLALAVSSDMFPGSGATPATLGKASPVLQRINPSLRESSSGKPRFTKCRSPE
LETFSCYWTEGDDHNLKVPGSIQLYYARRIAHEWTPEWKECPDYVSAGANSCYFNSSYTS
IWIPYCIKLTTNGDLLDEKCFTVDEIVQPDPPIGLNWTLLNISLPGIRGDIQVSWQPPPS
ADVLKGWIILEYEIQYKEVNETKWKTMSPIWSTSVPLYSLRLDKEHEVRVRSRQRSFEKY
SEFSEVLRVTFPQMDTLAACEEDFRFPWFLIIIFGIFGVAVMLFVVIFSKQQRIKMLILP
PVPVPKIKGIDPDLLKEGKLEEVNTILGIHDNYKPDFYNDDSWVEFIELDIDDADEKTEE
SDTDRLLSDDQEKSAGILGAKDDDSGRTSCYDPDILDTDFHTSDMCDGTSEFAQPQKLKA
EADLLCLDQKNLKNSPYDASLGSLHPSITLTMEDKPQPLLGSETESTHQLPSTPMSSPVS
LANIDFYAQVSDITPAGGVVLSPGQKIKAGLAQGNTQLEVAAPCQENYSMNSAYFCESDA
KKCIAAAPHMEATTCVKPSFNQEDIYITTESLTTTARMSETADTAPDAEPVPDYTTVHTV
KSPRGLILNATALPLPDKKKFLSSCGYVSTDQLNKIMQ
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atggatctttggcgggtgttcttaaccctggcactggcagtctccagcgacatgtttcct
ggaagtggggctacaccagctactcttggcaaagcttccccggttctgcaaagaattaat
ccaagcctgagggaaagttcctctggaaagcctcgattcaccaagtgtcgttcccctgaa
ctggagaccttttcatgctactggacagaaggggatgatcataatttaaaggtcccggga
tctattcagctatactatgctagaagaattgctcatgaatggaccccggaatggaaagaa
tgccctgattatgtctctgctggagcaaacagctgttacttcaactcatcgtatacctcc
atttggataccctactgcattaagcttactacaaatggtgatttgttggacgaaaagtgt
ttcactgttgatgaaatagtgcaacctgatccgcccattggcctcaactggactttacta
aacatcagtttgcctgggatccgtggagatatccaagtgagttggcagccaccgcccagt
gccgatgttctgaagggatggataattctggagtatgaaattcagtacaaagaagtaaat
gaaacaaaatggaaaacgatgagcccgatatggtcaacatcagtcccactgtactcactg
agactggataaagagcacgaagtgcgtgtgagatccagacaacggagcttcgaaaagtac
agcgagttcagtgaagtactccgtgtaacgtttcctcagatggacacactggcagcatgt
gaagaagatttccggtttccatggttcttaattattatctttggaatatttggagtagca
gtgatgctatttgtagttatattttcaaagcagcaaaggattaagatgctgattttaccc
ccagtaccagttccaaagattaaagggattgatccagatcttctcaaggaaggaaaattg
gaggaggtgaacaccatcttgggcattcatgataactacaaacccgacttctacaatgat
gactcctgggttgagttcattgagctggatattgatgatgcggatgagaagactgaagag
tcagacaccgacagacttctaagcgatgaccaggagaaatcagctggtatccttggagca
aaggatgacgattctggacgtaccagctgttatgaccctgacattttggataccgatttc
cacaccagtgacatgtgcgatggtacctcggagtttgctcagccgcagaagttaaaagca
gaagctgatctcttgtgccttgaccagaagaatctgaagaactcgccttatgatgcttcc
cttggctctctgcacccctccattaccctgacaatggaagacaaaccacagccacttctg
ggcagtgaaactgagtcaacccaccaactcccctctacaccaatgagcagtcccgtgtca
ctggcaaacattgacttttatgcccaagtaagcgacattacaccagcaggtggtgtagtc
ctttctccaggccaaaagattaaggcagggttagcccagggcaacacccagctggaggtg
gccgcgccctgccaagaaaattacagcatgaacagtgcctacttctgtgagtcagatgcc
aaaaagtgcatcgctgcggcccctcacatggaggccacgacatgtgtaaaaccaagcttt
aaccaagaggacatttacatcaccacagaaagccttaccactactgcccgaatgtccgag
acagcagataccgctccagatgctgagcctgtcccagactacaccacggttcacaccgtg
aagtccccaaggggccttatactcaacgcgactgctttgcctttgcctgacaaaaagaag
tttctctcctcatgtggctatgtgagcacagaccaactgaacaaaatcatgcagtag

DBGET integrated database retrieval system