KEGG   Rattus norvegicus (rat): 25236
Entry
25236             CDS       T01003                                 

Symbol
Gpc3
Name
(RefSeq) glypican-3 precursor
  KO
K08109  glypican 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    25236 (Gpc3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    25236 (Gpc3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    25236 (Gpc3)
Proteoglycans [BR:rno00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   25236 (Gpc3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Others
  25236 (Gpc3)
SSDB
Motif
Pfam: Glypican
Other DBs
NCBI-GeneID: 25236
NCBI-ProteinID: NP_036906
RGD: 2725
Ensembl: ENSRNOG00000060179
UniProt: P13265
Position
X
AA seq 597 aa
MAGTVRTACLLVAMLLGLGCLGQAQPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSD
LQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRH
AKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQ
MMNPGLPESVLDINECLRGARRDLKVFGSFPKLIMTQVSKSLQVTRIFLQALNLGIEVIN
TTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGCMAGVVEIDKYWREYIL
SLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNGGKLTTTIGKLCAHSQQRQYRSAY
YPEDLFIDKKVLKVARVEHEETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDTL
CWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSVPKG
KVVDKSLDEEGLESGDCGDDEDECIGSSGDGMMKVKNQLRFLAELAYDLDVDDAPGNKQH
GNQKDNEITTSHSVGNMPSPLKILISVAIYVACFFSWCTDLPCPCLCCPAAPCGPPT
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggccgggaccgtgcgcaccgcgtgcttgctggtggcgatgctgctcggcttgggctgc
ctgggacaggcgcagcccccgccgcctccagacgccacctgtcaccaggtccgttctttc
ttccagagactgcagcccggactcaaatgggttccagaaacccctgtgccaggatcagat
ttgcaagtatgtctccccaagggcccaacatgctgctcaagaaagatggaagaaaaatac
caactaacagcgcgcctgaacatggaacaactgctccagtctgcgagtatggaactcaag
ttcttaattattcagaatgctgcggttttccaagaggcctttgaaattgttgttcgccat
gccaagaactacaccaatgccatgttcaagaataactaccccagcctgactccacaagct
tttgagtttgtcggtgaatttttcacagatgtgtctctctacatcttgggttctgatatc
aatgtggatgatatggtcaatgaattgttcgacagcctctttccagtcatctatacccag
atgatgaacccaggcctccccgagtcagtattagacatcaacgagtgcctccgaggagca
agacgcgacctgaaagtatttggcagtttccccaagcttattatgacccaggtttccaag
tcactgcaagttactagaatcttccttcaggccctgaacctcggaattgaagtaatcaac
accaccgaccacctcaagtttagtaaggactgtggccgtatgctcacccgaatgtggtac
tgctcttactgccagggactgatgatggtcaaaccttgtggtggttattgcaatgtggtc
atgcaaggctgtatggcaggtgtggtagagatcgacaagtactggagagaatacattctg
tctcttgaagagctcgtgaacggcatgtacagaatctacgacatggagaatgtgctgctc
ggactcttttcaaccatccatgattccatccagtatgtgcagaagaacggaggcaagctg
accaccactattggcaagttgtgcgcccactcccagcaacgccaatatagatctgcttat
tatcctgaagatctgtttattgacaagaaggtattaaaagtcgcccgtgtcgaacatgaa
gaaaccttatccagccgaagaagggaactgattcagaagttgaagtctttcatcagcttc
tatagtgctttgccaggctacatctgcagccatagccccgtggccgaaaacgacaccctg
tgctggaacggacaagagcttgtggagagatacagccagaaggcggcaaggaatgggatg
aagaatcagtttaacctccatgagctgaaaatgaagggccctgagccagtggttagccag
atcattgacaaactgaagcacattaaccagctcctgagaaccatgtctgtgcccaagggt
aaagttgtggataaaagcctggatgaggaaggacttgagagtggagactgtggtgatgat
gaggatgagtgcatcgggagctctggtgacggcatgatgaaagtgaagaaccaactgcgc
ttccttgcagaactggcatatgatctggatgtggacgatgctccagggaacaagcaacat
ggaaatcagaaggacaacgagatcaccacctctcacagcgtggggaacatgccatcccca
ctgaaaatcctcatcagtgtggccatctacgtggcgtgctttttttcctggtgcactgac
ttgccatgcccatgcctgtgctgccctgcagcaccttgtggccctcctacataa

DBGET integrated database retrieval system