KEGG   Rattus norvegicus (rat): 25237Help
Entry
25237             CDS       T01003                                 

Gene name
Acvrl1, R-3, R3, SETHKIR
Definition
(RefSeq) activin A receptor like type 1
  KO
K13594  activin receptor-like kinase 1 [EC:2.7.11.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25237 (Acvrl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25237 (Acvrl1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     25237 (Acvrl1)
Protein kinases [BR:rno01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   25237 (Acvrl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS APH Pkinase_fungal Alpha_GJ DUF4381 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 25237
NCBI-ProteinID: NP_071886
RGD: 2029
Ensembl: ENSRNOG00000028713
UniProt: P80203
Position
7q36
AA seq 504 aa AA seqDB search
MTLGIFRRVFLMLSVALGLTKGDLVKPSRGQLVNCTCENPHCKRPICQGAWCTVVLVREQ
GRHPQVYRGCGSLNQELCLGRPTEFVNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDAHL
PLILGPVLALLVLVALGTLGLWRVRRRQEKQRGLHSDLGESSLILKASEQGDSMLGDFLV
SDCTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGSWHGESVAVKIFSSRDEQSW
FRETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEHGSLYDFLQRQTLEPQLA
LRLAVSAACGLAHLHVEIFGTQGKPAIAHRDLKSRNVLVKSNLQCCIADLGLAVMHSQSS
DYLDIGNNPRVGTKRYMAPEVLDEQIRTDCFESYKWTDIWAFGLVLWEIARRTIINGIVE
DYRPPFYDMVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSAR
LTALRIKKTLQKLSQNPEKPKVIH
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaccctggggattttccgaagggtctttttgatgctgtcggtggccttgggcctaact
aagggagacttggtgaagccctccaggggtcagctggtaaactgcacttgtgagaaccca
cactgcaagaggccaatctgccagggggcatggtgcacagtggtgctagttcgagagcag
ggcaggcacccccaggtctatcggggctgcgggagcctgaaccaggagctctgcctggga
cgtcccacggagtttgtgaaccatcactgctgctatagatccttctgcaaccacaatgtg
tccctgatgctggaggccacccaaactccttcggaggagccagaagtagatgcccatctg
cctctgatcctgggtcccgtgctggccttgctggtcctggtggccctgggcactctgggc
ttgtggcgtgtccggagaaggcaggagaagcagcggggtctgcacagtgacctgggcgag
tccagtctcatcctgaaggcatcggaacagggagacagcatgttgggggacttcctggtc
agcgactgtaccacaggcagcggctcagggctacccttcttggtgcagaggacagtagcg
cgacaggttgcactggtggagtgtgtgggaaagggccgatatggcgaggtgtggcgcggt
tcgtggcatggcgagagtgtggcggtcaagattttctcctcacgagatgagcagtcctgg
ttccgggagacagagatctacaacacagttctgcttagacacgacaacatcctaggcttc
atcgcctccgacatgacctcgcggaactccagcacgcagctgtggcttatcacccactac
cacgagcatggctccctctatgactttctgcagaggcagacgctggagccccagttggcc
ctgaggctggctgtgtccgcggcctgcggcctggcgcacctgcatgtagagatctttggc
actcaaggcaaaccagccatcgcccatcgtgacctcaagagccgcaacgtgctggtcaag
agcaacttgcagtgttgcattgcagacctgggattggctgtgatgcactcgcaaagcagc
gattacctggacattggtaacaacccccgagtgggtaccaagagatacatggcacccgag
gtgctggatgagcagatccgcacagactgttttgagtcgtacaagtggacagacatctgg
gccttcggcttagtgctatgggagattgcccggcggaccatcatcaatggcattgtggag
gactacaggccacccttctatgacatggtacccaatgaccccagttttgaggacatgaaa
aaggtggtgtgtgttgaccagcagacccccaccatccctaaccgactggcagcagatccg
gtcctctccgggctggcccagatgatgcgagagtgctggtaccccaacccctccgctcgc
ctcaccgcactgcgcataaagaagacattacagaagctcagccagaatccagagaaaccc
aaagtgattcactag

DBGET integrated database retrieval system