KEGG   Rattus norvegicus (rat): 25238
Entry
25238             CDS       T01003                                 

Gene name
Grk2
Definition
(RefSeq) beta-adrenergic receptor kinase 1
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04144  Endocytosis
rno04340  Hedgehog signaling pathway
rno04724  Glutamatergic synapse
rno04740  Olfactory transduction
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    25238 (Grk2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25238 (Grk2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    25238 (Grk2)
  09156 Nervous system
   04724 Glutamatergic synapse
    25238 (Grk2)
  09157 Sensory system
   04740 Olfactory transduction
    25238 (Grk2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    25238 (Grk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25238 (Grk2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25238 (Grk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     25238 (Grk2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   25238 (Grk2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   25238 (Grk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal DUF5647
Other DBs
NCBI-GeneID: 25238
NCBI-ProteinID: NP_036908
RGD: 2062
Ensembl: ENSRNOG00000018985
UniProt: P26817
Position
1
AA seq 689 aa
MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFS
QKLGYLLFRDFYLNHLEEAKPLVEFYEEIEKYEKLETEEERVVRSREIFDSYIMKELLAC
SHPFSKNATEHVQGHLVKKQVPPDLFQPYIEEICQNLRGDVFHKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE
LRSLLEGLLQRDVNRRLGCLGRGAQEIKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARK
KAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEDEAPQSL
LTMEEIQSVEETQIKERKCLLLKIRGGKQFVLQCDSDPELVQWKKELRDAYREAQQLVQR
VPKMKNKPRSPVVELSKVPLIQRGSANGL
NT seq 2070 nt   +upstreamnt  +downstreamnt
atggccgacctggaggcggtactggccgatgtgagctacctgatggccatggagaagagc
aaggccacgccggccgcgcgcgccagcaagaagatcctgctgccagagcccagcatccgc
agcgtcatgcagaagtatctagaggatcgaggagaagtgacctttgaaaagatcttctca
cagaagttaggatacctgcttttccgggacttctacctgaaccatctggaagaggccaag
cccttggtggagttctatgaagagatcgagaaatatgagaagctggagacggaggaggaa
cgtgtggtccgcagccgggagatctttgactcctacatcatgaaagaactgctggcctgc
tcacatcccttttcaaagaatgccacggagcatgtccagggccacctggtgaagaagcag
gtacctccagatctcttccagccatacattgaggagatttgtcagaacctccgaggggat
gtgttccacaaattcattgagagtgacaagttcacacggttctgccagtggaagaatgta
gagctcaacatccacctgaccatgaatgacttcagtgtgcatcgaatcatcgggcgtggg
ggcttcggtgaggtctatgggtgccggaaagcagacacaggcaagatgtacgccatgaag
tgtctggacaagaaacgcatcaagatgaagcagggagagaccctggctctgaacgagcgg
atcatgctttccctcgtcagcactggggactgccccttcatcgtgtgcatgtcatatgca
ttccacacaccagacaagctcagtttcatcctggatctcatgaacggtggggacctgcac
taccacttgtctcagcatggagtcttctctgaagccgacatgcgcttctacgcagctgag
atcatcctgggccttgaacacatgcacaatcgctttgtagtctacagggacctaaagcca
gccaacattctcctggatgagcatggccatgtgagaatctcagacctgggcctagcctgt
gacttctccaagaagaagcctcatgccagtgtgggcacacacgggtacatggccccggaa
gtcctacagaagggcgtggcctatgacagcagtgccgactggttctccctgggctgcatg
ctcttcaagttgttgcggggacacagccccttccggcagcacaagaccaaagacaagcat
gagattgaccgcatgacattgacaatggctgttgagctgcctgactccttctcccctgaa
ctccgatccctgctggaaggtttgctgcagagggatgtcaatcggagactaggctgtctg
ggccgtggggctcaagagataaaagaaagccccttcttccgttccctggactggcagatg
gtcttcttacagaagtaccctcctccactgatccccccacgcggggaggtgaatgcagcg
gacgcctttgacattggctcctttgatgaggaggacacaaaaggaatcaagttactggac
agtgaccaggaactgtaccgcaacttccctctcaccatctctgagcggtggcaacaggag
gtggcagagactgtctttgataccatcaatgctgagacagaccggctggaggcacggaag
aaagccaaaaacaaacagctgggccacgaggaggactacgccctgggtaaggactgcatc
atgcatggctacatgtccaagatgggcaaccccttcctgacccagtggcagcggcgatac
ttctacctgttccccaaccggcttgagtggaggggtgaagacgaggctccgcagagcctc
ctgaccatggaagagatccagtcggtggaagagacacagatcaaggaacgcaagtgtctc
ctgcttaagatccgaggtggcaagcagtttgtcctgcagtgtgatagtgaccctgagctg
gtgcaatggaaaaaagagctgcgcgatgcttaccgtgaggcccagcagctggtgcagcga
gtgcccaagatgaagaacaagccacgctcacctgtggtggagctgagcaaggtgccactg
attcagcgtggcagtgccaacggcctctga

KEGG   Rattus norvegicus (rat): 25372
Entry
25372             CDS       T01003                                 

Gene name
Grk3
Definition
(RefSeq) beta-adrenergic receptor kinase 2
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04144  Endocytosis
rno04340  Hedgehog signaling pathway
rno04724  Glutamatergic synapse
rno04740  Olfactory transduction
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    25372 (Grk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25372 (Grk3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    25372 (Grk3)
  09156 Nervous system
   04724 Glutamatergic synapse
    25372 (Grk3)
  09157 Sensory system
   04740 Olfactory transduction
    25372 (Grk3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    25372 (Grk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25372 (Grk3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25372 (Grk3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     25372 (Grk3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   25372 (Grk3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   25372 (Grk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 25372
NCBI-ProteinID: NP_037029
RGD: 2063
Ensembl: ENSRNOG00000059456
UniProt: P26819
Position
12
AA seq 688 aa
MADLEAVLADVSYLMAMEKSKAAPAARASKKVVLPEPSIRSVMQRYLAERNEITFDKIFN
QKIGFLLFKDFCLNEIGEAVPQVKFYEEIKEYEKLDNEEDRLHRSRQMYDAYIMRELLSS
THQFSKQAVEHVQSHLSKKQVTPTLFQPYIEEICESLRGDIFQKFMESEKFTRFCQWKNV
ELNIHLSMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRVKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDMHYHLSQHGVFSEKEMRFYASE
IILGLEHMHTCFVVYRDLKPANILLDEYGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTCYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVQLPDAFSPE
LRSLLEGLLQRDVSQRLGCCGGGARELKEHIFFKGIDWQYVYLRKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDCDQDLYKNFPLVISERWQQEVVETIYDAVNAETDKIEARK
KAKNKQLCQEEDYAMGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNL
LTMEQIMSVEETQIKDRKCILLRVKGGKQFVLQCESDPEFAQWLKELTCTFNEAQRLLRR
APKFLNKPRAAILEFSKPPLCHRNSSGL
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggcggacctggaggccgtgctggccgacgtcagctacctgatggccatggagaagagc
aaggcggcgccggccgcgcgcgccagcaagaaggtcgtcctgccggagcccagtatccgg
agtgtgatgcagaggtatctggcagaaagaaacgaaataacctttgacaagattttcaat
cagaaaatcggcttcctgctatttaaagatttctgcttgaatgaaatcggtgaagcggtg
cctcaggtgaaattttatgaagagataaaggaatacgagaaactggacaacgaagaagac
cggctgcaccggagtcggcagatgtacgacgcctacatcatgagggagcttctgtccagc
acacaccaattctcaaagcaagctgtagaacatgtccagagccatctctccaagaagcag
gtgacgcctaccctttttcagccgtacatagaagaaatctgcgaaagccttcgaggcgac
atcttccaaaagtttatggaaagcgaaaaattcactagattctgtcagtggaagaatgtg
gaattgaatattcacctgagcatgaacgacttcagtgtgcacaggatcatcggccgagga
gggtttggggaagtttacggctgcaggaaagcagacaccgggaaaatgtatgccatgaag
tgcttagacaagaagagagtgaagatgaaacagggagagacactggctttgaacgagagg
atcatgttgtctctcgtcagcactggggactgtcccttcattgtctgcatgacctatgcc
ttccacacaccagacaaactctgcttcatcctggacctgatgaacgggggcgacatgcac
taccacctctcccagcacggggtgttctctgagaaggagatgcgattttatgccagcgag
atcatcctgggcctcgagcacatgcacacctgctttgtagtctacagagacctgaagcct
gcgaacatcctcctggatgaatatgggcatgtgaggatatcggatcttggcctggcctgc
gatttctctaaaaagaagcctcacgccagtgtgggcacccatgggtacatggctcccgag
gtgttgcagaaggggacatgctacgacagcagcgccgactggttctccctgggctgcatg
ctcttcaagctcctgcggggccacagccctttcaggcagcataaaaccaaagacaagcat
gagatagaccgcatgaccctgaccgtgaacgtgcagcttccagatgccttctcccctgag
ctgaggtccctcttggagggtttgctccagcgggatgtgagccagcgactgggctgctgc
ggaggaggggcacgagagttgaaggagcacatcttcttcaagggcatcgactggcagtat
gtgtacttacggaagtacccgccacccctaatccctcctcggggagaggtcaatgccgca
gacgcctttgatattggctcgtttgatgaagaagataccaaaggcattaagctgttggac
tgcgaccaggacctctataagaacttcccgctggtgatttctgagcgctggcagcaggaa
gtagtggagaccatctacgacgccgtcaatgccgaaactgataaaattgaggccaggaag
aaggctaaaaataaacagctttgtcaagaagaagattatgccatggggaaggactgcatc
atgcacggatacatgctgaagctggggaacccctttctcacacagtggcaaagacgttat
ttttacctgtttcccaacagactggagtggagaggagagggcgagtctcggcaaaatcta
ctgaccatggaacagatcatgtctgtggaggagacccaaattaaagacagaaaatgcatt
ttactcagggtaaaaggagggaagcagtttgttttgcaatgtgagagtgaccccgagttt
gcacagtggctgaaagagctgacgtgcaccttcaacgaggcccagagactgctgcgccgc
gcccccaagttcctcaacaaaccacgtgccgccatcctggagttctccaagccaccgctg
tgtcacagaaatagcagcggcctctga

KEGG   Rattus norvegicus (rat): 59075
Entry
59075             CDS       T01003                                 

Gene name
Grk5
Definition
(RefSeq) G protein-coupled receptor kinase 5
  KO
K08291  G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04144  Endocytosis
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    59075 (Grk5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    59075 (Grk5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    59075 (Grk5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    59075 (Grk5)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.16  G-protein-coupled receptor kinase
     59075 (Grk5)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   59075 (Grk5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Kinase-like Pkinase_fungal Sulfakinin
Other DBs
NCBI-GeneID: 59075
NCBI-ProteinID: NP_110456
RGD: 61985
Ensembl: ENSRNOG00000011439
UniProt: Q62833 Q66HL7
Position
1
AA seq 590 aa
MELENIVANTVLLKAREGGGGKRKGKSKKWKEILKFPHISQCEDLRRTIDRDYYSLCDKQ
PIGRLLFRQFCETRPGLECYIQFLDLVAEYEITPDENLGAKGKEIMTKYLSPKSPVFIAQ
VGQDLVSQTEKKLLQSPCKELFSACAQSVHDYLKGDPFHEYLDSMYFDRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRIKKRKGESMALNEKQILEK
VNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNPGFEEERALFYAAEILCGLE
DLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGDLIRGRVGTVGYMAPEVLNNQ
RYGLSPDYWGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSPKFSEEAKSIC
NMLLTKDSKQRLGCQEEGAAEVKRHPFFRNMNFKRLEAGMLDPPFVPDPRAVYCKDVLDI
EQFSTVKGVNLDHTDDDFYSKFSTGSVPIPWQNEMIETECFKELNVFGPNGTLSPDLNRS
QPPEPPKKGLFHRLFRRQHQNNSKSSPTPKTSCNHRINSNHINSNSTGSS
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggagctggaaaacatcgtggccaacacggtcttgctgaaagcccgggaagggggtgga
ggaaaacgcaaagggaaaagcaagaagtggaaggaaatcctgaagtttcctcacatcagc
cagtgtgaagacctccggagaaccatagacagagattactacagtctatgtgacaagcaa
ccaattgggagactgctttttcgacaattctgtgaaaccaggcctggactggagtgctac
attcagttcctggacttagtggcagaatatgaaattactccagatgaaaaccttggggca
aaggggaaggaaataatgaccaagtacctctctccaaagtccccagtcttcattgcccaa
gttggacaggacctggtctcccagacagagaagaagctcctgcagagcccctgcaaagaa
ctcttctctgcttgtgctcagtctgtccatgactacttgaagggagaccccttccacgag
tacctggacagcatgtattttgaccgttttctgcagtggaaatggttagaaagacaacca
gtgaccaaaaacactttccggcagtaccgagtgctgggcaaagggggctttggagaggtt
tgtgcctgccaggttcgggccactggtaaaatgtatgcttgcaaacgcttagagaagaag
aggatcaaaaaaaggaaaggagagtccatggcactcaatgaaaagcagattcttgagaaa
gtcaacagccagtttgtggtcaacctggcctatgcctacgagaccaaagatgcactgtgc
ttggttctgaccattatgaatggaggtgacctgaagtttcacatctacaacatgggaaat
cctggctttgaggaagaacgagccttgttttatgcagctgagatcctctgtggcctggaa
gacttacaccgtgagaacactgtctatagagatctaaaaccagaaaacatcttgctggat
gattatggccacatcaggatctcagacctaggactggctgtgaagatccctgagggggac
cttatccgtggccgggtaggcactgttggctacatggccccagaagttctgaacaaccag
cgatatggcctgagccctgactactggggcctgggctgcctcatctatgagatgatcgag
ggccagtcaccattccgaggccgcaaggagaaggtgaagcgggaagaggtggatcgccgg
gtgctggagactgaggaagtgtattcccccaagttctctgaagaggccaagtccatctgc
aacatgctgctcaccaaagactcgaagcagaggctgggctgccaggaggagggggctgcc
gaggtcaagaggcaccccttcttcaggaacatgaactttaaacgcctggaggctgggatg
ttggaccctcccttcgttccagatccccgggctgtatactgcaaggatgtgctggacata
gagcagttctccactgtgaaaggtgtcaacttggaccatacggacgatgacttctactca
aagttctccacaggctctgtgccaatcccatggcaaaacgagatgatagaaacagaatgt
ttcaaggagctgaatgtgttcggacccaacggtaccctctcaccagacctgaacagaagt
cagcctccagaaccaccaaagaaagggctgttccacagactcttcaggcgtcagcatcaa
aacaattccaagagttcacctactcctaagaccagttgtaaccaccgcataaattcaaac
cacatcaattcaaactccactggaagcagctag

KEGG   Rattus norvegicus (rat): 59076
Entry
59076             CDS       T01003                                 

Gene name
Grk6
Definition
(RefSeq) G protein-coupled receptor kinase 6 isoform c
  KO
K08291  G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04144  Endocytosis
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    59076 (Grk6)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    59076 (Grk6)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    59076 (Grk6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    59076 (Grk6)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.16  G-protein-coupled receptor kinase
     59076 (Grk6)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   59076 (Grk6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 59076
NCBI-ProteinID: NP_001106183
RGD: 61986
Ensembl: ENSRNOG00000014615
UniProt: P97548
Position
17
AA seq 576 aa
MELENIVANTVLLKAREGGGGNRKGKSKKWRQMLQFPHISQCEELRLSLERDYHSLCERQ
PIGRLLFREFCATRPELTRCTAFLDGVAEYEVTPDEKRKACGRRLMQNFLSHTGPDLIPE
VPRQLVSNCAQRLEQGPCKDLFQELTRLTHEYLSMAPFADYLDSIYFNRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKQILEK
VNSRFVVSLAYAYETKDALCLVLTLMNGGDLKFHIYHMGQAGFPEARAVFYAAEICCGLE
DLHRERIVYRDLKPENILLDDHGHIRISDLGLAVHVPEGQTIKGRVGTVGYMAPEVVKNE
RYTFSPDWWALGCLLYEMIAGQSPFQQRKKKIKREEVERLVKEVAEEYTDRFSPQARSLC
SQLLNKDPAERLGCRGGGAREVKEHPLFKKLNFKRLGAGMLEPPFKPDPQAIYCKDVLDI
EQFSTVKGVDLEPTDQDFYQKFATGSVSIPWQNEMVETECFQELNVFGLDGSVPPDLDWK
GQPTAPPKKGLLQRLFSRQDCCGNCSDSEEELPTRL
NT seq 1731 nt   +upstreamnt  +downstreamnt
atggagctcgagaacatcgtagcgaacacggtgctactcaaggcccgggaaggtggtggc
gggaatcgtaaaggcaagagcaagaaatggcgccagatgctgcagttcccccacatcagc
cagtgtgaagagctccggctcagccttgaacgtgactaccacagcctgtgtgagcgtcag
cccattgggcgcctgttatttcgtgagttctgcgctacgaggcctgagctgacccgctgt
actgccttcctggatggggtggctgagtatgaggtgacccctgatgagaaacggaaggca
tgtgggcgtcggctaatgcagaattttctgagccacacgggtcctgacctcatccctgaa
gttccccggcagctggtgagtaactgtgcccagcggctagagcagggaccctgcaaagac
ctcttccaggagctgacccggctgacccatgagtacctaagcatggccccttttgccgac
tacctcgacagcatctacttcaaccgtttcctgcagtggaagtggctggaaaggcagcca
gtgaccaaaaacacctttaggcagtaccgagtcctgggcaaaggtggctttggggaggtg
tgtgcctgccaggtgcgggcaacaggcaagatgtatgcgtgcaaaaaactggaaaagaaa
cgaataaagaagcggaagggggaggccatggctctcaacgagaagcagatcctggagaaa
gtgaacagtaggtttgtagtgagcttagcctacgcatatgagaccaaggatgcactgtgc
ctggtgctgacattgatgaatggaggcgacctcaagttccacatctaccacatgggccag
gctggctttcccgaagcacgtgctgtcttctatgctgccgagatctgctgtggtctggag
gacttacaccgggaacgcatcgtgtacagggacctaaagccagagaatatccttctggat
gaccatggccacattcgaatctccgacctgggcctggctgtgcatgttcctgagggccag
accatcaaaggccgtgtgggcactgtgggctacatggctccagaggtggtgaagaatgag
cgctacacattcagtcctgactggtgggcgctaggctgcctcctgtacgagatgattgcg
ggacagtcgcccttccagcagaggaagaagaagatcaagcgggaggaggtggagcggctg
gtcaaggaggtggctgaggagtacaccgaccgcttctccccacaggcacgctcactctgt
tctcagcttctcaacaaggaccctgctgagcgcctggggtgtcgtggaggtggtgcccgt
gaggtaaaggagcacccccttttcaagaaactgaatttcaagcggctgggagctggaatg
ctagaaccaccttttaaacctgacccccaggccatttactgcaaggacgtgctggacatt
gaacagttctccacagttaaaggtgtggatctggagcccacagaccaagacttctaccag
aagtttgccacgggtagtgtgtccatcccctggcagaacgagatggtggagactgagtgc
ttccaggaactaaatgtctttgggctggatgggtctgttcccccagacctggactggaag
ggccagcccactgcaccccccaagaagggattgctacagagactcttcagtagacaagat
tgctgtgggaactgcagcgacagtgaagaagagctccccacccgcctctag

KEGG   Rattus norvegicus (rat): 59077
Entry
59077             CDS       T01003                                 

Gene name
Grk4
Definition
(RefSeq) G protein-coupled receptor kinase 4
  KO
K08291  G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04144  Endocytosis
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    59077 (Grk4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    59077 (Grk4)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    59077 (Grk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    59077 (Grk4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.16  G-protein-coupled receptor kinase
     59077 (Grk4)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   59077 (Grk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 59077
NCBI-ProteinID: NP_075217
RGD: 61858
Ensembl: ENSRNOG00000011847
UniProt: P70507
Position
14
AA seq 575 aa
MELENFMANTLLLKARQGFTKKTGRSKKWRELLKLPPVSMCSDLRHSIEKDFSSLCDQQP
IGRLLFRQFCNTKPDLKRCIEFLDAAAEYEVTIEEEQREFGLSIYSRFFKENSEVSLPQI
PPDLVKECKCNLKQSSPSQNVFQDCAGVIYKYLSEKPFEEYQESTYYNRFLQWKWLERRP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKRILEK
LHSRFVVSLAYTYETKDALCLVLTIMNGGDLKYHIYNLGNPGFEEQRAVFYAAELCCGLE
DLQRERIVYRDLKPENILLDDHGHIRISDLGLALEIPEGEMVRGRVGTVGYMAPEIISHE
KYTFSPDWWGLGCLIYEMIAGHSPFRKYKEKVNREEMERRVKTETEEYSERFSENAKSIC
SMLLTKDPSKRLGCQSDGASAVKQHPIFKDINFSRLEANMLDPPFCPDPEAIYCKDILDI
GQFSVVKGVNLDTNDEIFYTQFATGCVTIPWQNEMIESGCFKDLNEYEDKGLSPLEKHKI
CSCILRPKRNFFHRLFRRAACLNIAHSEEREPTEH
NT seq 1728 nt   +upstreamnt  +downstreamnt
atggaactggagaacttcatggccaacactttgttgctgaaggctcgtcaaggatttacc
aaaaagactggtcgcagtaaaaagtggagagagctcctgaagttgcccccagtcagcatg
tgcagtgacttacgacactccatcgaaaaggattttagcagtctttgtgaccaacagcca
atcggaagacttcttttcagacaattctgtaatacgaaaccagatctaaagaggtgcatt
gaattcttggatgcagcggcagagtatgaagttaccatcgaagaggaacaaagagaattt
ggactatccatctacagtagattcttcaaagagaattcagaagtctccttaccacagata
cctccagatcttgtgaaggagtgtaaatgcaatctgaagcagagttctccctctcaaaat
gtgttccaggactgtgctggagttatctataagtatttgagtgaaaaaccatttgaagaa
taccaagagagtacatactataatcgatttttacaatggaaatggctagaaaggcgtcca
gtaacaaagaacacattcagacaatacagagttttaggaaaaggcggatttggagaggtt
tgtgcctgtcaagtgcgagctacaggaaaaatgtatgcctgcaaaaaactagaaaaaaaa
agaataaagaagaggaaaggtgaagccatggctctgaatgaaaaaagaatcttagaaaaa
ttgcatagtagatttgtagttagtttagcctacacttatgaaaccaaggatgctttgtgt
ttggtgctaaccattatgaatggaggggatttgaagtaccacatttacaacctgggcaat
cctggctttgaggagcagagagctgtgttctatgctgcagagctgtgctgtggcttggaa
gatttacagagggaaagaattgtatacagagacctaaaaccagagaatatcctccttgat
gatcatggacacatccgaatttcagatcttggtctagctctggaaatcccagaaggggag
atggttcgaggaagagttggtactgttggctacatggctccagaaattatcagtcatgaa
aagtatacatttagtcctgattggtggggacttggctgtctgatatatgaaatgattgcg
ggacattctccattcagaaaatataaagaaaaagtcaaccgggaggaaatggaaagaaga
gtgaagactgaaactgaggagtactctgagaggttttcagagaatgccaagtccatctgc
agcatgttacttaccaaggatccaagtaaaaggctgggctgccagagtgatggagcctct
gctgtaaagcagcacccaatattcaaggatattaacttcagcagactggaagcaaatatg
ttagacccacctttctgtcctgatcctgaggccatttattgtaaggatatcttggatatt
ggacagttctctgtggtgaaaggagtcaacctggacaccaatgatgagatcttctacact
caatttgcgacagggtgtgtcaccattccctggcagaatgagatgattgaatctggatgt
ttcaaggacctcaatgaatatgaagataaaggtctgtcaccacttgaaaaacacaagata
tgttcctgtattcttagaccaaagagaaacttcttccatagactcttcagaagagcggcc
tgcctgaacattgcccacagtgaggagagggagccaacagaacactga

KEGG   Rattus norvegicus (rat): 81760
Entry
81760             CDS       T01003                                 

Gene name
Grk1
Definition
(RefSeq) rhodopsin kinase GRK1
  KO
K00909  rhodopsin kinase [EC:2.7.11.14]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04144  Endocytosis
rno04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    81760 (Grk1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    81760 (Grk1)
  09157 Sensory system
   04744 Phototransduction
    81760 (Grk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    81760 (Grk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.14  rhodopsin kinase
     81760 (Grk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   81760 (Grk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Pkinase_fungal Kinase-like FTA2 ABC1
Other DBs
NCBI-GeneID: 81760
NCBI-ProteinID: NP_112358
RGD: 619712
Ensembl: ENSRNOG00000018430
Vega: OTTRNOG00000000950
UniProt: Q63651
Position
16
AA seq 564 aa
MDFGSLETVVANSAFIAARGSFDGSSTPSSRDKKYLAKLRLPPLSKCEGLRDSISLEFDN
LCSEQPIGKRLFQQFLKTDERHVPALELWKDIEDYDTADDDLRPQKAQAILAEYLDPQGT
LFCNFLDQGMVARVKEGPTGSQDGLFQPLLQATLEHLSQGPFQEYLGSLYFLRFLQWKWL
EAQPIGEDWFLDFRVLGKGGFGEVSACQMKATGKMYACKKLNKKRLKKRKGYQGAIVEKR
ILAKVHSRFIVSLAYAFETKTDLCLVMTIMNGGDVRYHIYNVDEENPGFPEPRAIYYTAQ
IISGLEHLHQRRIVYRDLKPENVLLDNDGNIRISDLGLAVELKEGQNKTKGYAGTPGFMA
PELLRGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKQRIISEPVKYPEKFS
QASKDFCEQLLEKDPEKRLGFRDGTCDALRANVLFKDISWRQLEAGMLIPPFIPDSRTVY
AKNIQDVGAFSTVKGVVFDKADTEFFQEFASGNCSIPWQEEMIETGFFGDLNVWRPDGQM
PDDMKGITVEEAAPTAKSGMCLIS
NT seq 1695 nt   +upstreamnt  +downstreamnt
atggatttcgggtccttggaaaccgtggtggccaactctgccttcattgcggcccgaggc
agctttgacggaagcagcaccccctcttcccgagacaagaagtatctggccaagctccgg
ttgcccccactgtccaagtgtgagggtctccgtgacagcatcagcctagagtttgacaac
ctgtgctcggagcagcccattggcaagaggctcttccagcagttcctgaagacagacgag
aggcatgtgccggctctggagctctggaaggacatcgaggactatgacactgccgatgac
gacctacggccacagaaggctcaggccatcctggctgagtacctggacccacagggcaca
ctcttctgcaacttcctggaccagggcatggtggcaagagtgaaggaagggccaactggg
agccaggatgggctcttccagcctctgctgcaggccacactggagcacttgagtcagggc
cccttccaggagtacctgggaagcctatatttcctgcggtttcttcagtggaagtggttg
gaagcccagcccataggtgaagactggtttttggacttcagggtcctggggaaggggggc
tttggggaagtgtccgcctgccaaatgaaggcgaccggcaagatgtacgcttgcaagaag
ctgaacaagaagcggctgaagaagaggaaggggtaccagggcgccatcgttgagaagagg
attctagctaaagtacacagcaggttcatcgtgtctctggcctatgcattcgaaaccaag
accgacctctgtctggtgatgaccatcatgaatggaggtgacgtaaggtaccacatctac
aatgtggatgaggagaaccccggctttccggagccacgagccatctactacacagcacag
atcatcagtggcctggagcacctgcatcagagacgcattgtctaccgtgacctcaagcca
gagaacgtgctgctggacaacgatggcaacatccgaatttctgaccttggactggccgtc
gagttgaaggaagggcagaataagaccaagggctatgcagggaccccaggtttcatggcc
cccgagctcctgcgaggcgaagagtacgacttctctgtggactactttgccctgggggtc
acattgtacgagatgatcgcagccagaggacccttccgagcccgaggagagaaggtggag
aacaaggagcttaaacagcgcatcatctcagagcccgtgaagtacccagagaagttcagc
caggccagcaaggacttctgtgagcagctgttagagaaggacccggagaagcgcctgggt
ttccgggatggaacctgtgacgccctaagggcgaatgtcctcttcaaagatatcagctgg
agacagctcgaagccggaatgctcatccctccgttcatcccagactctaggactgtctat
gccaagaacattcaggatgtgggtgccttttccacagtcaagggtgtggtttttgacaaa
gcagacacagaattcttccaagaattcgcctccggcaactgctccattccctggcaggag
gagatgattgagactgggttcttcggggacctcaacgtgtggcgcccagacggtcaaatg
cccgatgacatgaagggaatcaccgtggaggaggcagcccctacagccaaatcagggatg
tgtctcatctcctag

DBGET integrated database retrieval system