KEGG   Rattus norvegicus (rat): 25240
Entry
25240             CDS       T01003                                 

Gene name
Aqp1
Definition
(RefSeq) aquaporin-1
  KO
K09864  aquaporin-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04924  Renin secretion
rno04964  Proximal tubule bicarbonate reclamation
rno04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    25240 (Aqp1)
  09154 Digestive system
   04976 Bile secretion
    25240 (Aqp1)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    25240 (Aqp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25240 (Aqp1)
   04147 Exosome [BR:rno04147]
    25240 (Aqp1)
Transporters [BR:rno02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    25240 (Aqp1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25240 (Aqp1)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 25240
NCBI-ProteinID: NP_036910
RGD: 2141
Ensembl: ENSRNOG00000011648
UniProt: P29975
Position
4
AA seq 269 aa
MASEIKKKLFWRAVVAEFLAMTLFVFISIGSALGFNYPLERNQTLVQDNVKVSLAFGLSI
ATLAQSVGHISGAHLNPAVTLGLLLSCQISILRAVMYIIAQCVGAIVASAILSGITSSLL
ENSLGRNDLARGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGH
LLAIDYTGCGINPARSFGSAVLTRNFSNHWIFWVGPFIGSALAVLIYDFILAPRSSDFTD
RMKVWTSGQVEEYDLDADDINSRVEMKPK
NT seq 810 nt   +upstreamnt  +downstreamnt
atggccagcgaaatcaagaagaagctcttctggagggctgtggtggctgagttcctggcc
atgaccctcttcgtcttcatcagcatcggttctgccctaggcttcaattacccactggag
agaaaccagacgctggtccaggacaatgtgaaggtgtcactggcctttggtctgagcatc
gctactctggcccaaagtgtgggtcacatcagtggtgctcacctcaacccagcggtcaca
ctggggcttctgctcagctgtcagatcagcatcctccgggctgtcatgtatatcatcgcc
cagtgtgtgggagccatcgttgcctccgccatcctctccggcatcacctcctccctgctc
gagaactcacttggccgaaatgacctggctcgaggtgtgaactccggccagggcctgggc
attgagatcattggcaccctgcagctggtgctgtgcgttctggctaccactgaccggagg
cgccgagacttaggtggctcagccccacttgccattggcttgtctgtggctcttggacac
ctgctggccattgactacactggctgtgggatcaaccctgcccggtcatttggctctgct
gtgctcacccgcaacttctcaaaccactggattttctgggtgggaccattcattgggagt
gccctggcagtgctgatctatgacttcatcctggccccacgcagcagcgactttacagac
cgcatgaaggtgtggaccagtggccaggtggaggagtatgacctggatgctgatgatatc
aactccagggtggagatgaagcccaaatag

DBGET integrated database retrieval system