KEGG   Rattus norvegicus (rat): 25241Help
Entry
25241             CDS       T01003                                 

Gene name
Aqp5
Definition
(RefSeq) aquaporin 5
  KO
K09867  aquaporin-5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    25241 (Aqp5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25241 (Aqp5)
Transporters [BR:rno02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    25241 (Aqp5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-GeneID: 25241
NCBI-ProteinID: NP_036911
RGD: 2144
Ensembl: ENSRNOG00000051970
UniProt: P47864
Position
7q36
AA seq 265 aa AA seqDB search
MKKEVCSLAFFKAVFAEFLATLIFVFFGLGSALKWPSALPTILQISIAFGLAIGTLAQAL
GPVSGGHINPAITLALLIGNQISLLRAVFYVAAQLVGAIAGAGILYWLAPLNARGNLAVN
ALNNNTTPGKAMVVELILTFQLALCIFSSTDSRRTSPVGSPALSIGLSVTLGHLVGIYFT
GCSMNPARSFGPAVVMNRFSPSHWVFWVGPIVGAMLAAILYFYLLFPSSLSLHDRVAVVK
GTYEPEEDWEDHREERKKTIELTAH
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggaggtgtgctcccttgccttcttcaaggcggtgttcgcagagttcctggcc
accctcatcttcgtcttctttggcctgggctcagcactcaagtggccctcggctctgccc
accattctgcaaatctcaattgcctttggcctggccataggtaccttagcccaagctctg
ggacctgtgagtggtggccacatcaatccagccattactctggccctcttaataggaaac
cagatctcgctgctccgagctgtcttctacgtggcagcccagctggtgggcgccattgct
ggggcaggcatcctgtactggctggcgccactcaatgcccggggtaacctggccgtcaat
gcgctgaacaacaacacaacgcctggcaaggccatggtggtggagttaatcttgactttc
cagctagccctctgcatcttctcctccaccgactctcgccgaaccagccctgtgggctcc
ccagccttatccattggcttgtctgtcacactgggccatcttgtggggatctacttcacc
ggctgttccatgaacccagcccgatctttcggccctgcggtggtcatgaaccggttcagc
ccctctcactgggtcttctgggtagggcctattgtgggggccatgctggcggccatcctc
tatttctacctgctcttcccctcctctctgagcctccatgatcgcgtggctgtcgtcaaa
ggcacatatgagccggaggaggactgggaagatcatcgagaggagaggaagaagaccatc
gagctgacggcacactga

DBGET integrated database retrieval system