KEGG   Rattus norvegicus (rat): 25242Help
Entry
25242             CDS       T01003                                 

Gene name
Arnt, Arnt1
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator
  KO
K09097  aryl hydrocarbon receptor nuclear translocator
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04066  HIF-1 signaling pathway
rno04934  Cushing syndrome
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    25242 (Arnt)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25242 (Arnt)
   05204 Chemical carcinogenesis
    25242 (Arnt)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    25242 (Arnt)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    25242 (Arnt)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25242 (Arnt)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    25242 (Arnt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4
Motif
Other DBs
NCBI-GeneID: 25242
NCBI-ProteinID: NP_036912
RGD: 2153
Ensembl: ENSRNOG00000031174
UniProt: P41739
Position
2q34
AA seq 800 aa AA seqDB search
MAATTANPEMTSDVPSLGPTIASGNPGPGIQGGGAVVQRAIKRRSGLDFDDEGEVNSKFL
RCDDEQMCNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLK
TGTVKKEGQQSSMRMCMGSRRSFICRMRCGTSSVDPVSMNRLSFLRNRCRNGLGSVKEGE
PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNICQP
TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
QVLSVMFRFRAKNREWLWMRTSSFTFQNPYSDEMSIFICTNTNVKNSSQEPRPTLSNTIQ
RSQLGPTTNLSLEMGTGVLASRQQQQQQQQQQQQQQQQTELDMVPGRDGLASYSHSQVSV
QPVATAGSEHSKPLEKSEGLFVQDRDPRFSEIYPNISADQSKGLSSSTVPATQQLFSQGS
SFPPNPRPAENFRNSGLTPPVTIVQPSSSAGQILAQISRHSNLTQGSAPTWTSSTRPGFS
AQLPTQATAKTRSSQFGVNNFQTSSSFSAMSLPGAPTASPSTAAYPTLPNRGSNFPPETG
QTTGQFQTRTAEGVGVWPQWQGQQPHHRSSSNEQHVQPTSAQPSSQPEVFQEMLSMLGDQ
SNTYNNEEFPDLTMFPPFSE
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgactacagctaacccagaaatgacatcagatgtgccatcactgggtcccacc
attgcttctggaaatcccggacctgggattcaaggtggaggagctgttgtccagagggct
attaagcgacggtcagggctggattttgatgatgaaggagaagtgaacagtaaatttttg
agatgtgacgatgagcagatgtgtaacgacaaagagcggtttgccaggtcggatgatgag
cagagctctgccgataaagagagacttgccagggaaaatcatagtgaaatagagcggcgg
cgacggaacaagatgacagcttacatcacagaactgtcagacatggtacctacctgtagt
gccctggctcgaaaaccagacaagctaaccatcttacgcatggctgtttctcacatgaag
tccttgaggggaacgggcaatacatccactgacggctcctacaagccgtccttcctcact
gatcaggaactgaaacatttgattttggaggcagcagatggttttctgtttattgtctct
tgtgagactggccgagtggtgtatgtctctgactcggtgactcccgttttgaaccagcca
cagtctgaatggtttgggagcacactgtatgaccaagtgcacccagatgatgtggataaa
cttcgagagcagctttctacttcagaaaatgccctaacagggcggatcctggatctgaag
actggaacagtgaaaaaggaaggtcagcagtcttccatgaggatgtgcatgggctcaaga
agatcgttcatctgccggatgaggtgtggcaccagctctgtggaccctgtttccatgaat
agactgagctttttgaggaacagatgcaggaatggacttggctctgtgaaggaaggagag
cctcactttgtggtagtccactgcacaggttacatcaaggcctggccaccagcaggtgtc
tccctcccagatgatgatccagaggctggccaggggagcaaattctgcctagtggccatt
ggcaggctgcaggtaaccagttctcctaactgtacagatatgagtaacatctgtcagcca
acagagttcatctccagacataacattgaagggatattcacttttgtagatcatcgttgt
gtggctactgttggctaccagccacaggagctcttaggaaagaatattgtagaattttgt
catcctgaagaccaacaacttctaagagacagctttcagcaggtggtgaaattaaaaggc
caagtgctgtctgtcatgttccgattccgagctaagaaccgagaatggctgtggatgaga
acaagctcctttactttccaaaacccgtattcagatgaaatgagtatatttatctgcacc
aacaccaacgtgaagaactctagccaggaaccacggcctacattgtctaacacaatccag
aggtcacagctaggtccgacaactaatttatccctagagatgggtacaggtgtcctggca
tccaggcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagacagaa
ttggatatggtaccaggaagagatgggctggccagctatagtcattcccaggtttctgtc
cagcccgtggcaactgcaggatcagaacacagcaagccccttgagaagtcagaaggtctc
tttgtgcaggacagagatccgaggttttcagaaatctatcccaacatcagtgcagatcag
agtaaaggcctctcctccagcactgtccctgccacccaacagctgttctcccagggcagc
tcattccctcctaacccccggccggcagaaaatttcaggaatagtggtcttacccctccc
gtaaccattgtccagccgtcatcttctgcagggcagatattggcccagatttctcgtcac
tccaaccttacccagggatcagcaccaacttggacctctagcactcgcccaggtttctct
gcccagctgcctactcaggctacagccaagactcgttcttcacaatttggtgtgaacaac
tttcagacttcgtcctccttcagtgccatgtctcttccgggtgctcccactgcctcaccc
agtactgctgcctaccctactcttcctaaccgtggatccaactttcctcctgagactgga
cagacaacaggacagttccagacccggacagcagagggtgtgggtgtctggccacagtgg
caaggccagcagccccatcaccggtctagttccaatgagcaacatgttcagccaacatca
gcacaaccaagtagccagcctgaggtctttcaagaaatgctgtccatgctgggggaccag
agcaacacctacaacaatgaagagtttcctgatctaactatgtttccccctttttctgaa
tag

DBGET integrated database retrieval system