KEGG   Rattus norvegicus (rat): 25242
Entry
25242             CDS       T01003                                 

Gene name
Arnt
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator isoform 1
  KO
K09097  aryl hydrocarbon receptor nuclear translocator
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04066  HIF-1 signaling pathway
rno04934  Cushing syndrome
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    25242 (Arnt)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25242 (Arnt)
   05204 Chemical carcinogenesis
    25242 (Arnt)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    25242 (Arnt)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    25242 (Arnt)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25242 (Arnt)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    25242 (Arnt)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4 DUF2368 VIT1
Other DBs
NCBI-GeneID: 25242
NCBI-ProteinID: NP_036912
RGD: 2153
Ensembl: ENSRNOG00000031174
UniProt: P41739
Position
2
AA seq 810 aa
MAATTANPEMTSDVPSLGPTIASGNPGPGIQGGGAVVQRAIKRRSGLDFDDEGEVNSKFL
RCDDEQMCNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLK
TGTVKKEGQQSSMRMCMGSRRSFICRMRCGTSSVDPVSMNRLSFLRNRCRNGLGSVKEGE
PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNICQP
TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
QVLSVMFRFRAKNREWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQ
RSQLGPTTNLSLEMGTGQLASRQQQQQQQQQQQQQQQQQQQQQQQQQQTELDMVPGRDGL
ASYSHSQVSVQPVATAGSEHSKPLEKSEGLFVQDRDPRFSEIYPNISADQSKGLSSSTVP
ATQQLFSQGSSFPPNPRPAENFRNSGLTPPVTIVQPSSSAGQILAQISRHSNLTQGSAPT
WTSSTRPGFSAQLPTQATAKTRSSQFGVNNFQTSSSFSAMSLPGAPTASPSTAAYPTLPN
RGSNFPPETGQTTGQFQTRTAEGVGVWPQWQGQQPHHRSSSNEQHVQPTSAQPSSQPEVF
QEMLSMLGDQSNTYNNEEFPDLTMFPPFSE
NT seq 2433 nt   +upstreamnt  +downstreamnt
atggcggcgactacagctaacccagaaatgacatcagatgtgccatcactgggtcccacc
attgcttctggaaatcccggacctgggattcaaggtggaggagctgttgtccagagggct
attaagcgacggtcagggctggattttgatgatgaaggagaagtgaacagtaaatttttg
agatgtgatgatgagcagatgtgtaacgacaaagagcggtttgccaggtcggatgatgag
cagagctctgcggataaagagagacttgccagggaaaatcatagtgaaatagagcggcgg
cgacggaacaagatgacagcttacatcacagaactgtcagacatggtacctacctgtagt
gccctggctcgaaaaccagacaagctaaccatcttacgcatggctgtttctcacatgaag
tccttgaggggaacgggcaatacatccactgacggctcctacaagccgtccttcctcact
gatcaggaactgaaacatttgattttggaggcagcagatggttttctgtttattgtctct
tgtgagactggccgagtggtgtatgtctctgactcggtgactcccgttttgaaccagcca
cagtctgaatggtttgggagcacactgtatgaccaagtgcacccagatgatgtggataaa
cttcgagagcagctttctacttcagaaaatgccctaacagggcggatcctggatctgaag
actggaacagtgaaaaaggaaggtcagcagtcttccatgaggatgtgcatgggctcaaga
agatcgttcatctgccggatgaggtgtggcaccagctctgtggaccctgtttccatgaat
agactgagctttttgaggaacagatgcaggaatggacttggctctgtgaaggaaggagag
cctcactttgtggtagtccactgcacaggttacatcaaggcctggccaccagcaggtgtc
tccctcccagatgatgatccagaggctggccaggggagcaaattctgcctagtggccatt
ggcaggctgcaggtaaccagttctcctaactgtacagatatgagtaacatctgtcagcca
acagagttcatctccagacataacattgaagggatattcacttttgtagatcatcgttgt
gtggctactgttggctaccagccacaggagctcttaggaaagaatattgtagaattttgt
catcctgaagaccaacaacttctaagagacagctttcagcaggtggtgaaattaaaaggc
caagtgctgtctgtcatgttccgattccgagctaagaaccgagaatggctgtggatgaga
acaagctcctttactttccaaaacccgtattcagatgaaattgagtatattatctgcacc
aacaccaacgtgaagaactctagccaggaaccacggcctacattgtctaacacaatccag
aggtcacagctaggtccgacaactaatttatccctagagatgggtacagggcagctggca
tccaggcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcag
cagcagcagcagcagcagcagcagacagaattggatatggtaccaggaagagatgggctg
gccagctatagtcattcccaggtttctgtccagcccgtggcaactgcaggatcagaacac
agcaagccccttgagaagtcagaaggtctctttgtgcaggacagagatccgaggttttca
gaaatctatcccaacatcagtgcagatcagagtaaaggcctctcctccagcactgtccct
gccacccaacagctgttctcccagggcagctcattccctcctaacccccggccggcagaa
aatttcaggaatagtggtcttacccctcccgtaaccattgtccagccgtcatcttctgca
gggcagatattggcccagatttctcgtcactccaaccttacccagggatcagcaccaact
tggacctctagcactcgcccaggtttctctgcccagctgcctactcaggctacagccaag
actcgttcttcacaatttggtgtgaacaactttcagacttcgtcctccttcagtgccatg
tctcttccgggtgctcccactgcctcacccagtactgctgcctaccctactcttcctaac
cgtggatccaactttcctcctgagactggacagacaacaggacagttccagacccggaca
gcagagggtgtgggtgtctggccacagtggcaaggccagcagccccatcaccggtctagt
tccaatgagcaacatgttcagccaacatcagcacaaccaagtagccagcctgaggtcttt
caagaaatgctgtccatgctgggagaccagagcaacacctacaacaatgaagagtttcct
gatctaactatgtttccccctttttctgaatag

KEGG   Rattus norvegicus (rat): 25243
Entry
25243             CDS       T01003                                 

Gene name
Arnt2
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator 2
  KO
K15589  aryl hydrocarbon receptor nuclear translocator 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25243 (Arnt2)
   05202 Transcriptional misregulation in cancer
    25243 (Arnt2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    25243 (Arnt2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25243 (Arnt2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    25243 (Arnt2)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 25243
NCBI-ProteinID: NP_036913
RGD: 2154
Ensembl: ENSRNOG00000013017
UniProt: Q78E60
Position
1
AA seq 712 aa
MATPAAVNPPEMASDIPGSVTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGP
SKFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTG
NKSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFG
STLYEQVHPDDVEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICR
MRCGNAPLDHLPLNRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMSIPEED
ADVGQGSKYCLVAIGRLQVTSSPVCMDMSGMSVPTEFLSRHNSDGIITFVDPRCISVIGY
QPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWLLIRTSSFTF
QNPYSDEIEYVICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPTGVHEAGKPV
EKADAIFSQERDPRFAEMFAGISASEKKMMSSASASGSQQIYSQGSPFPAGHSGKAFSSS
VVHVPGVNDIQSSSSTGQNISQISRQLNQGQVAWTGSRPPFPGQPSKTQSSAFGIGSSHP
YPADPSSYSPLSSPAASSPSGNAYPSLANRTPGFAESGQSGGQFQGRPSEVWSQWQSQHH
GQQSGEQHSHQQPGQTEVFQDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggcaaccccggccgccgtcaaccctccggaaatggcttcagacatacctggatctgtg
accttgcctgttgcccccatggcggccacgggacaggtgagaatggcaggggccatgcct
gcccgaggaggaaagcggcgatccggaatggactttgatgacgaagatggtgaaggtccc
agtaaattttcaagagagaaccacagtgagattgagcggcgcaggcggaacaagatgact
caatatattacggaactctccgacatggttcccacctgcagtgcactagctaggaagcca
gacaagctcaccattctacgcatggcggtctcacacatgaagtccatgaggggcaccggc
aacaaatctactgacggcgcatataagccttccttcctcactgagcaggaactgaagcat
ctcatccttgaagctgctgacggatttctgtttgtggtggctgccgagacagggagagta
atctacgtgtctgattctgtcactcctgtcctgaaccagccacagtcagagtggtttggg
agcacactctatgaacaggtgcaccctgatgacgtggagaaactgagagaacagctgtgt
acttcagaaaactccatgacaggccgcatcctagacctgaagactgggacagtgaagaag
gagggacagcagtcgtccatgcgcatgtgtatgggctcccggcgctccttcatctgtaga
atgaggtgtggaaatgctcccttggaccacctgcctttgaacagaataaccaccatgagg
aaaaggttcaggaatggccttggccctgtgaaagaaggagaagcccaatatgccgtggtc
cactgcacaggttacatcaaggcttggccaccagcaggaatgagcatacccgaagaagat
gctgatgttggacaaggcagtaaatattgccttgtggcaatcgggaggctccaggtgacc
agctctcctgtgtgcatggacatgagtggcatgtcagtgcccacggagttcctgtctcgg
cataactctgatgggatcatcacgtttgtagacccaagatgcatcagtgtgattggctac
cagccccaggaccttctgggaaaagatattttggaattctgccaccctgaggatcagagc
cacctacgggagagcttccagcaggtggttaaactgaagggccaagtgctgtcggtcatg
tacaggttccgcaccaagaaccgggagtggctgttgatccgcaccagcagcttcaccttc
cagaacccctactctgatgagatcgagtatgtcatctgcaccaacaccaacgtcaagcaa
cttcagcagcagcaggcagagctggaggtacaccagcgagacgggctgtcatcatatgac
ttgtctcaggtcccggtacccaacctacccactggtgttcatgaggcagggaagcctgtg
gaaaaggcagatgcgatcttctcccaagagagagaccctcgttttgctgagatgtttgca
ggcatcagtgcatcggagaagaagatgatgagctcagcctcagcatccggcagccagcag
atctactcccaaggaagtccattccctgccgggcactcgggcaaggccttcagctcttct
gtggtccatgtgcctggagtgaatgacattcagtcctcctcctcaacgggccagaacata
tcccagatctcccggcagctgaaccagggccaggtggcatggacaggcagccgtccaccc
ttcccagggcagcccagcaagacgcagtcatctgccttcggaattggatcaagccacccc
tacccagccgacccttcatcctacagtcctctctccagcccagctgcctcctcaccaagc
ggaaacgcataccccagtcttgccaacaggactccagggtttgctgagagtggacagagt
ggagggcaattccagggccggccctcagaggtctggtcccagtggcagagccagcatcac
ggacagcagagcggtgagcagcactcccaccagcagcctggccagactgaagtgttccag
gacatgctacccatgccgggcgacccgacgcaggggactggcaactataacatcgaggac
tttgctgacctgggcatgttccctccattttctgagtag

DBGET integrated database retrieval system