KEGG   Rattus norvegicus (rat): 25245Help
Entry
25245             CDS       T01003                                 

Gene name
Bdkrb2, B2BKR, B2BRA
Definition
(RefSeq) bradykinin receptor B2
  KO
K03916  bradykinin receptor B2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04071  Sphingolipid signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04610  Complement and coagulation cascades
rno04750  Inflammatory mediator regulation of TRP channels
rno04810  Regulation of actin cytoskeleton
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno05142  Chagas disease (American trypanosomiasis)
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    25245 (Bdkrb2)
   04071 Sphingolipid signaling pathway
    25245 (Bdkrb2)
   04022 cGMP-PKG signaling pathway
    25245 (Bdkrb2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25245 (Bdkrb2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25245 (Bdkrb2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    25245 (Bdkrb2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    25245 (Bdkrb2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    25245 (Bdkrb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25245 (Bdkrb2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    25245 (Bdkrb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25245 (Bdkrb2)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Bradykinin
    25245 (Bdkrb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 25245
NCBI-ProteinID: NP_775123
RGD: 2201
Ensembl: ENSRNOG00000047300
UniProt: P25023 A0A0H2UI29
Position
6q32
AA seq 392 aa AA seqDB search
MHCSWKRPVLLSVHEPMPTTASLGIEMFNITTQALGSAHNGTFSEVNCPDTEWWSWLNAI
QAPFLWVLFLLAALENIFVLSVFCLHKTNCTVAEIYLGNLAAADLILACGLPFWAITIAN
NFDWLFGEVLCRVVNTMIYMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSL
VIWSCTLLLSSPMLVFRTMKDYREEGHNVTACVIVYPSRSWEVFTNMLLNLVGFLLPLSI
ITFCTVRIMQVLRNNEMKKFKEVQTEKKATVLVLAVLGLFVLCWFPFQISTFLDTLLRLG
VLSGCWNERAVDIVTQISSYVAYSNSCLNPLVYVIVGKRFRKKSREVYQAICRKGGCMGE
SVQMENSMGTLRTSISVDRQIHKLQDWAGNKQ
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcactgttcttggaagcgacccgtgctcctgtccgtgcatgagcccatgcccaccaca
gcctctctgggcattgaaatgttcaacatcaccacgcaagccctggggtctgctcataac
gggaccttttcagaggtcaactgcccagacactgagtggtggagctggctcaatgccatc
caggcccccttcctctgggtcctcttcctgctggccgcactggagaacatctttgtcctc
agcgtgttctgtctgcacaaaaccaactgcactgtggctgagatctacctgggcaacctg
gcagccgcggacctcatcctggcctgcggattacccttctgggccatcaccatcgccaat
aacttcgactggctgttcggagaggtgctgtgccgcgtggtgaataccatgatctacatg
aacctctacagcagcatctgcttcctgatgcttgtgagtatcgaccgatacctggcgctg
gtgaagaccatgtccatgggccggatgcgcggggtacgctgggccaaactgtacagcctg
gtgatctggagctgtacgctgcttctgagttcacccatgttggtgttcaggaccatgaag
gactacagggaagagggccacaacgtcacggcctgcgtcattgtctacccgtcccgctcc
tgggaggtgttcaccaacatgctgctgaacctggtgggtttcctcctacccctgagtatc
atcaccttctgcacggtgcgaatcatgcaggtgctgaggaacaacgagatgaagaagttc
aaggaggtccagacggagaagaaggccactgtgctggtgctggctgtcctggggctcttt
gtgctgtgttggtttcctttccagatcagcaccttcctggacacgctgctgcggcttggc
gtgctgtcgggatgctggaacgagcgtgccgtggatattgtcacccagatcagttcctac
gtggcctatagcaacagctgcctcaacccgctggtgtacgtgattgtgggcaagcgcttc
cgaaagaagtcccgagaggtgtaccaggcaatatgccggaagggaggctgcatgggagag
tccgtccagatggagaactccatggggactctgaggacctctatctcggtggaccggcag
atccacaagctgcaggattgggcggggaacaagcagtga

DBGET integrated database retrieval system