KEGG   Rattus norvegicus (rat): 25248Help
Entry
25248             CDS       T01003                                 

Gene name
Cnr1, SKR6R
Definition
(RefSeq) cannabinoid receptor 1
  KO
K04277  cannabinoid receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    25248 (Cnr1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25248 (Cnr1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    25248 (Cnr1)
  09159 Environmental adaptation
   04714 Thermogenesis
    25248 (Cnr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25248 (Cnr1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Cannabinoid
    25248 (Cnr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx YlaC
Motif
Other DBs
NCBI-GeneID: 25248
NCBI-ProteinID: NP_036916
RGD: 2369
Ensembl: ENSRNOG00000008223
UniProt: P20272
Position
5q21
AA seq 473 aa AA seqDB search
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEENIQCGENFMDMECFMILNPSQQLAI
AVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHV
FHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCL
MWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILW
KAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPL
LAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTA
QPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgatcctagatggccttgcagacaccaccttccgtaccatcaccacagacctc
ctctacgtgggctcgaatgacattcagtatgaagatatcaaaggagacatggcatccaaa
ttaggatacttcccacagaaattccctctaacttccttcaggggtagtcccttccaagaa
aagatgaccgcaggagacaactccccgttggtcccagcaggagacacaacaaacattaca
gagttctataacaagtctctctcgtcgttcaaggagaatgaggagaacatccagtgtggg
gagaactttatggacatggagtgctttatgattctgaatcccagccagcagctggccatc
gctgtactgtccctcacactgggcaccttcacggttctggagaacctactggtgctgtgt
gtcatcctgcactcccgcagtctccgatgcaggccttcctaccacttcatcggcagcctg
gcagtggccgacctcctgggaagtgtcatttttgtgtacagctttgttgacttccatgta
ttccaccgtaaagacagccccaatgtgtttctgttcaaactgggtggggttacagcctcc
ttcacagcttctgtgggcagcctgttcctcacagccatcgacaggtacatatccattcac
aggcctctggcctataagaggatcgtcaccaggcccaaggccgttgtggccttttgcctg
atgtggactatcgcaatagtaatcgctgtgttgcctctcctgggctggaactgcaagaag
ctgcaatctgtttgctcggacattttcccactcattgacgagacctacctgatgttctgg
attggggtgaccagtgtgctgctgctgttcattgtgtacgcgtacatgtacattctctgg
aaggctcacagccacgcggtccgcatgattcagcgtgggacccagaagagcatcatcatc
cacacgtcagaagacggcaaggtgcaggtgacccggcctgaccaagcccgcatggacatt
aggctggccaaaaccctggttctgatcctggtggtgttgatcatctgctggggccctctg
cttgcgatcatggtgtatgacgtcttcgggaagatgaacaagcttatcaagacggtgttt
gccttctgcagtatgctctgcctgctgaactccaccgtgaaccccatcatctatgctctg
aggagcaaggacctgagacatgctttccgaagcatgttcccttcgtgcgaaggcaccgca
cagcctctagacaacagcatgggggactcagactgcctgcacaagcacgccaacaacaca
gccagcatgcacagggccgcggagagctgcatcaagagcaccgttaagatcgcgaaggtg
accatgtctgtgtccacagacacgtccgccgaggctctgtga

DBGET integrated database retrieval system