KEGG   Rattus norvegicus (rat): 25252
Entry
25252             CDS       T01003                                 

Gene name
Dlg1, Dlgh1, SAP97
Definition
(RefSeq) discs large MAGUK scaffold protein 1
  KO
K12076  disks large protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04390  Hippo signaling pathway
rno04530  Tight junction
rno04660  T cell receptor signaling pathway
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    25252 (Dlg1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    25252 (Dlg1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    25252 (Dlg1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    25252 (Dlg1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25252 (Dlg1)
   05165 Human papillomavirus infection
    25252 (Dlg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    25252 (Dlg1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    25252 (Dlg1)
SSDB
Motif
Pfam: Guanylate_kin PDZ MAGUK_N_PEST L27_1 PDZ_assoc PDZ_6 PDZ_2 SH3_1 SH3_2 SH3_9
Other DBs
NCBI-GeneID: 25252
NCBI-ProteinID: NP_036920
RGD: 2505
Ensembl: ENSRNOG00000038597
UniProt: Q62696
Structure
PDB: 

Position
11q22
AA seq 911 aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVISIFQSNLFQALIDIQEFYEVTL
LDNPKCVDHSKQCEPVQPGNPWESGSLSSAAVTSESLPGGLSPPVEKYRYQDEEVLPSER
ISPQVPNEVLGPELVHVSEKSLSEIENVHGFVSHSHISPIKPTEAVPPSSPIVPVTPALP
VPAESPVVLPSTPQANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAG
GTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEADVRDVTHSKAVEALKEAG
SIVRLYVKRRKAFRKNHEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHK
DGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKAAKPTSMYINDGYAPPDITN
SSSQSVDNHVSPSSYLGQTPASPARYSPISKAVLGDDEITREPRKVVLHRGSTGLGFNIV
GGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTI
VAQYRPEEYSRFEAKIHDLRETMMNSSVSSGSGSLRTSQKRSLYVRALFDYDKTKDSGLP
SQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKFN
SKTRGDKGEIPDDMGSKGLKHVTSNASDSESSYHEYGCSKGGQEEYVLSYEPVNQQEVNY
TRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDI
QEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPK
SMENIMEMNKRLTDEQARKTFERAVRLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSG
PYIWVPAKEKL
NT seq 2736 nt   +upstreamnt  +downstreamnt
atgccggtccggaagcaagatacccagagagcattgcatctgttggaagaatatcggtcg
aaactaagccaaaccgaagacagacagctcaggagttccatagagcgggttattagcata
tttcagagcaacctctttcaggctttaatagacattcaagaattttatgaagtgacctta
cttgataatccaaaatgtgtggatcattcaaagcagtgtgaaccggtccaacccgggaat
ccttgggagagtggcagcctttcaagtgctgctgtgacttcagagagcctgcccggcggc
cttagccctccagtagagaaataccggtatcaggacgaagaggtgctgccttcagagcgg
atttccccgcaagtcccaaatgaggtgctgggtccggagctggttcacgtctcggagaag
agcctgtcagagattgagaatgtccacgggtttgtctctcactctcatatctcacccata
aagcccacagaagctgttcctccctcctctcccattgtccctgtgacccctgccttgcca
gtccctgctgagagtcctgtcgtcctgccctccacaccacaggcaaatcctcctcctgtc
ctggtcaacacagacagcttggagacaccaacttatgttaatggtactgatgcagattat
gaatatgaggaaatcacacttgaaaggggaaattcaggcttgggtttcagcattgcagga
ggtacagacaacccacacattggagatgactcaagtattttcatcaccaaaattatcacg
ggaggagcagctgcccaggatggaagattgcgggtaaatgactgtatactgagagtaaat
gaagcagatgttcgtgatgtaacccacagcaaagcagttgaagcattgaaagaagctgga
tcgatagtgcgattatatgtgaaaaggcggaaggccttcagaaaaaatcatgaaataaaa
cttattaaaggccctaaaggtcttgggttcagcattgctggaggtgttggaaaccagcac
attcctggggataacagcatctatgtaaccaaaataattgaaggaggtgcagcacacaag
gacggcaaacttcagattggagacaagcttctagcagtgaacagtgtctgtttagaagaa
gttactcatgaagaagcagtgactgccttaaagaatacatctgattttgtttatttgaaa
gcggcaaaaccaacaagtatgtatataaatgatggctatgcaccacccgacatcactaat
tcttcttctcagtctgttgacaaccatgttagcccgtcttcatacttgggccagactcca
gcgtcaccagccagatactcacccatttctaaagcagtgcttggagatgatgagatcact
agggaacctagaaaagttgttcttcatcgtggctcaacgggacttggtttcaacattgtg
ggaggcgaagatggagaagggatttttatctctttcatccttgctgggggacctgctgac
ctaagcggagagctcagaaaaggagatcgcattatatcggtaaacagtgttgacctcaga
gctgcaagtcatgaacaagcagctgccgcattaaaaaacgcaggccaagctgtcactatt
gtcgcacagtatcggcctgaagagtacagtcgttttgaagctaaaattcacgacttgcgg
gagacgatgatgaacagcagtgtcagctcagggtcagggtctctccgaaccagccaaaag
cggtccctctatgtcagagccctttttgattacgacaagactaaagacagtggccttccc
agtcaagggttgaacttcaaattcggagatattctccatgttatcaatgcttctgatgac
gagtggtggcaggccagacaggtgaccccagatggtgagagtgacgaagttggagtaatt
cctagtaaacgcagagttgagaagaaagaacgagcccgattaaaaacagtcaaattcaat
tctaaaacaagaggagataaaggggagatccctgacgacatgggatcaaaaggcctgaag
cacgtaacttctaatgccagcgatagcgaaagtagttaccatgaatatggctgctcaaaa
ggtggtcaagaagaatatgttttatcgtatgagccggtgaatcagcaagaagttaattat
acccgaccagtcatcatattaggacctatgaaagacagagtaaatgatgacttaatctca
gaatttcctgacaaatttggatcctgtgtccctcatacaactagaccaaagcgtgactat
gaggtggatggacgagattaccattttgtgacttcaagagaacagatggagaaagatatc
caggagcataaattcattgaagctggccagtataacaaccatctatacggaacgagtgtc
caatctgtgcgagcagtagcagagaagggcaagcattgtatccttgatgtgtctggaaat
gccatcaagaggttgcagattgcacagctctatccaatatctatttttattaaacccaaa
tccatggaaaatatcatggaaatgaataaacgcctaacagacgaacaggccagaaaaacg
tttgagagagcagtgagactggagcaggagttcactgagcatttcacagctattgtccag
ggagacacgctggaggacatttacaatcaagtgaagcagatcatagaagagcagtctggt
ccttacatctgggtcccagcaaaagaaaaattatga

DBGET integrated database retrieval system