KEGG   Rattus norvegicus (rat): 25253Help
Entry
25253             CDS       T01003                                 

Gene name
Dpp4, CD26, DPPIV
Definition
(RefSeq) dipeptidylpeptidase 4
  KO
K01278  dipeptidyl-peptidase 4 [EC:3.4.14.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    25253 (Dpp4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    25253 (Dpp4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25253 (Dpp4)
   04090 CD molecules [BR:rno04090]
    25253 (Dpp4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.5  dipeptidyl-peptidase IV
     25253 (Dpp4)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   25253 (Dpp4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   25253 (Dpp4)
  Exosomal proteins of epithelial cells
   25253 (Dpp4)
  Exosomal proteins of colorectal cancer cells
   25253 (Dpp4)
CD molecules [BR:rno04090]
 Proteins
  25253 (Dpp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DPPIV_N Peptidase_S9 DPPIV_rep DLH LIP Abhydrolase_6 Hydrolase_4 Abhydrolase_3 AXE1 Peptidase_S15
Motif
Other DBs
NCBI-GeneID: 25253
NCBI-ProteinID: NP_036921
RGD: 2515
Ensembl: ENSRNOG00000030763
UniProt: P14740
Structure
PDB: 

Position
3q21
AA seq 767 aa AA seqDB search
MKTPWKVLLGLLGVAALVTIITVPVVLLNKDEAAADSARTYTLADYLKNTFRVKSYSLRW
VSDSEYLYKQENNILLFNAEHGNSSIFLENSTFEIFGDSISDYSVSPDRLFVLLEYNYVK
QWRHSYTASYSIYDLNKRQLITEEKIPNNTQWITWSQEGHKLAYVWKNDIYVKIEPHLPS
HRITSTGKENVIFNGINDWVYEEEIFGAYSALWWSPNGTFLAYAQFNDTGVPLIEYSFYS
DESLQYPKTVWIPYPKAGAVNPTVKFFIVNTDSLSSTTTTIPMQITAPASVTTGDHYLCD
VAWVSEDRISLQWLRRIQNYSVMAICDYDKTTLVWNCPTTQEHIETSATGWCGRFRPAEP
HFTSDGSSFYKIVSDKDGYKHICQFQKDRKPEQVCTFITKGAWEVISIEALTSDYLYYIS
NEYKEMPGGRNLYKIQLTDHTNKKCLSCDLNPERCQYYSVSLSKEAKYYQLGCRGPGLPL
YTLHRSTDQKELRVLEDNSALDKMLQDVQMPSKKLDFIVLNETRFWYQMILPPHFDKSKK
YPLLIDVYAGPCSQKADAAFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINKRLG
TLEVEDQIEAARQFLKMGFVDSKRVAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRW
EYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQI
SKALVDAGVDFQAMWYTDEDHGIASSTAHQHIYSHMSHFLQQCFSLR
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaccgtggaaggttcttctgggactgcttggtgtcgctgcgcttgtcaccatc
atcaccgtgccagtggttctgctgaacaaagatgaagcggccgctgatagcgcgagaact
tacacactagctgactatttaaagaatacctttcgggtcaagtcctactccttgcggtgg
gtttcagattctgaatacctctacaagcaagaaaacaatatcttgctattcaatgctgaa
cacgggaacagctccattttcttggagaacagtacctttgagatctttggagattctata
agtgattattcagtgtcacccgacagactgttcgttctcttagaatacaattatgtgaag
caatggagacactcctacacggcttcatacagtatttatgacttgaataaaagacagctg
atcacagaagagaagattccaaataatacacagtggatcacatggtcacaagaaggtcac
aaattggcatatgtctggaagaatgatatttatgttaaaattgaaccacatttgcctagt
cataggatcacatcaacaggaaaagaaaatgtaatatttaacggaataaatgactgggtt
tatgaagaggaaatcttcggtgcctactccgcactgtggtggtctccaaacggcactttt
ctagcttatgcccagtttaacgacaccggagtgcctctcattgaatactccttctactct
gatgagtcactgcagtaccccaagacagtctggattccgtacccaaaggcaggagctgtg
aatccaactgtaaagttctttattgtaaatacagactctctcagctcaactactactacg
attcccatgcaaatcaccgctcctgcatctgtgacaacaggggatcactacttgtgtgac
gtggcctgggtttcagaagacagaatctcgttgcagtggctcaggaggattcagaactat
tccgtgatggcgatctgcgactatgataagaccaccctagtatggaactgtccaacgacg
caggagcatattgaaacgagtgccacaggctggtgcggaagatttaggcctgcagaaccc
cacttcacctccgacggaagcagcttctataaaatcgtcagtgacaaagatggctacaaa
cacatctgccagttccagaaagataggaaacccgaacaggtctgtacatttattacaaaa
ggagcctgggaagtcattagtatcgaagctctgaccagcgattatctgtactacattagt
aatgaatataaagaaatgccaggaggaagaaatctttataaaattcagcttactgaccac
acaaataagaagtgccttagttgtgacctgaatccagaaagatgccagtattactcggtg
tcacttagtaaagaggcaaagtactatcagctgggatgccggggccctggtctgcccctc
tacactctgcatcgcagcactgatcaaaaagagctgagagtcctggaggacaattctgct
ttggataaaatgctgcaagatgtccaaatgccttcaaaaaaattggacttcattgttctg
aatgaaacaagattttggtatcaaatgatcttacctcctcattttgataaatccaagaaa
taccctctactaatagatgtatatgcaggtccctgtagtcaaaaagcagatgctgccttc
agactcaactgggccacttaccttgcaagcacagaaaacatcatagtagctagctttgat
ggcagaggaagtggttaccaaggagataagatcatgcatgcaatcaacaaaagacttgga
acactggaagttgaagatcaaattgaagcagccaggcaatttttaaaaatgggatttgtg
gacagcaagcgagttgcaatttggggctggtcatatggagggtacgtaacctcaatggtc
ctgggatcgggaagtggcgtgttcaagtgtggaatagccgtggcgcccgtgtcacggtgg
gagtactatgactcagtatacacagagcgttacatgggtctcccaactccagaggacaac
cttgaccattacaggaactcaacagtcatgagcagagctgaaaattttaagcaagttgag
tacctccttattcacggtacagcagatgataatgttcactttcagcagtcagctcagatc
tccaaagccctggtggatgctggcgtggatttccaagcaatgtggtacacggacgaagac
catgggatcgccagcagcacagctcaccagcacatctattcccacatgagccatttcctc
cagcagtgcttctccttacgctag

DBGET integrated database retrieval system