KEGG   Rattus norvegicus (rat): 25254
Entry
25254             CDS       T01003                                 

Gene name
Dspp, Dsp, RDSP2
Definition
(RefSeq) dentin sialophosphoprotein
  KO
K23573  dentin sialophosphoprotein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    25254 (Dspp)
SSDB
Other DBs
NCBI-GeneID: 25254
NCBI-ProteinID: NP_036922
RGD: 2525
Ensembl: ENSRNOG00000002168
UniProt: Q8VBY1
Position
14p22
AA seq 970 aa
MKTKIIIYICIWATAWAIPVPQLVPLERDIVEKSADVPFLAHPGTAAQNELHINNATNDD
SPKGSELGRQVHSNGGYERDRNGSESIAVGGKSSPTQPILANAQGNSAKEREDVETYGHD
GIHAGGENSTANGIRGQVGIAENAEEAKESKVHGQPHQDTKTGLASDTSQNGDATLVQEN
EPQVAGSKNSTNHEVGTHGSGVAAQETTPQREGEGSENQGAEVTPSIGEGAGLDNTEGSP
SGNGIEEDEDTGSGDGVGADAGDGRESHDGTEGHEGQSSGGNNDNRGQGSVSTEDDDSKE
QEGSPNGRGGDNTSSSEETGIEEGDGTQTTQDNQNLSPTEGGIISQAEACPSGQSQNQGL
ETEGSSTGNKSSITKESGKLSGSKDSNGHHGMELDKRNSPKQGESDKPQGAAEKSDTHNN
MGHSRIGSSSNSDGHDSYDFDDESMQGDDPNSSDESNGSDGSDDANSESAIENGNHGDAS
YTSDESSDNGSDSDSHAGEDDSSDDTSDTDDSDSNGDDDSESKDKDESDNSNHDNDSDSE
SKSDSSDSDSDSSDSSDSSDSSDSSESSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSDSS
DSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSDSSDSSDSSDSSDSSDSSDSSDS
SDSSDSSDSSDSSESSDSSDSSDSSDSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSS
DSDSSDSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSDSSDSSDSSDSSDSSDSS
DSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSNSSD
SSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDGDSSDGDSSDSDSSD
SDSSNSSDSDSSDSSDSSSSDSSDSDSDSKDSTSDSSDDNSKSGNGNSDSDSDSDSDSEG
SDSNHSTSDD
NT seq 2913 nt   +upstreamnt  +downstreamnt
atgaaaacgaagataattatatatatttgcatttgggcaaccgcatgggccattccggtc
cctcagttagtgccgctggagagagacattgttgaaaaatctgccgacgtaccctttcta
gcacatccaggaaccgcagcacagaatgagttgcatatcaacaacgccactaacgacgat
tccccaaagggcagtgagctaggaaggcaggtacactctaatgggggttacgaaagagac
aggaatggctccgagtcgatagccgtaggagggaagagttctcctactcagcccatttta
gcaaacgcacaggggaacagtgctaaagaacgcgaggacgtagaaacatacggtcacgat
gggatacacgcaggaggagagaacagcacagcaaacggcatcaggggccaagtaggcatc
gctgaaaatgccgaggaagcaaaggagagtaaggtacacgggcagcctcatcaggataca
aaaactggccttgccagtgacacgagccagaatggagacgccacccttgtccaggaaaat
gagcctcaggtagccggaagcaagaatagcacaaaccatgaggttggaacacacgggagt
ggagttgctgcacaggaaacgacaccgcagagagaaggggaggggagtgagaaccagggg
gctgaggtgacaccaagcattggggaaggtgctggtttggataatactgaagggagtcct
agcgggaacgggatagaggaggatgaagacacgggttctggtgatggtgtgggtgcagac
gcaggagatggaagggagagtcacgatggcacggagggccacgagggccagtctagtggg
ggaaacaatgacaacagaggtcagggttcagttagtactgaagacgatgactctaaagaa
caagaaggctccccaaatggacgtggtggggacaacacctccagcagtgaagaaaccggt
attgaagaaggcgatggtacccaaacaacacaggacaaccagaatctcagtcccacagag
ggtgggattatcagccaggcagaagcatgtccttctgggcagagccaaaatcagggatta
gaaaccgaaggttccagcacgggcaacaaaagtagtattaccaaagaatctgggaagctc
agtggaagtaaagacagcaacggacaccatggaatggagctggacaaaaggaatagccca
aagcaaggggagtctgacaagccccaaggggctgccgagaagtcagacacccataacaac
atgggacacagcaggataggcagcagcagcaatagtgacgggcatgacagttatgatttt
gacgatgagtccatgcaaggagacgatcccaacagcagtgacgagtctaacggaagtgac
ggaagtgatgatgctaactccgaaagcgccattgagaatggcaaccatggagatgcttct
tacacctctgatgaatcaagcgataatggcagcgacagtgactcacatgctggagaggat
gacagcagtgatgacacatctgataccgatgacagtgacagtaacggtgatgatgacagt
gagagtaaggacaaggacgaatcagacaacagtaaccacgacaatgacagtgacagtgag
agcaaatcagacagcagcgacagtgacagtgacagcagtgacagcagtgacagcagtgac
agtagcgacagcagcgaaagcagtgacagtagcgacagtagcgacagcagtgacagcagt
gacagcagtgacagtagcgacagcagtgacagcagtgacagcagcgacagtgacagcagc
gacagtgacagcagtgacagtagtgacagcagtgacagtagtgacagcagtgacagtagt
gacagcagtgacagcagcgacagtagtgacagtagtgacagcagcaacagtgacagcagt
gacagtagcgacagcagtgacagtagcgacagcagtgacagtagtgacagcagtgacagc
agcgacagcagtgacagcagtgacagcagtgacagcagcgaaagcagtgacagcagtgac
agtagcgacagcagcgacagtgacagcagtgacagcagtgacagtagtgacagcagtgac
agcagtgatagcagcgacagtagtgatagcagtgacagcagtgacagcagtgacagcagc
gacagtgacagcagcgacagtgacagcagtgacagtagtgacagcagtgacagtagtgac
agcagtgacagtagtgacagcagtgacagcagcgacagtagtgacagtagtgacagcagc
aacagtgacagcagtgacagtagcgacagcagtgacagtagcgacagcagtgacagtagt
gacagcagtgacagcagcgacagcagtgacagcagtgacagcagtgacagcagcgacagt
agtgatagcagtgacagcagtgacagcagtgacagcagtgacagtagtgacagcagtgac
agcagtgatagcagtgacagcagtgacagtagcgacagcagcgatagcaacagtagtgac
agcagtgacagcagtgacagtagtgacagcagcgacagcagtgacagtagtgacagtagt
gacagcagtgacagcagtgacagcagtgacagcagcaacagcagcgacagcagtgacagc
agtgacagcagcgatggtgacagcagtgacggtgacagcagcgatagtgacagcagtgat
agtgacagtagtaacagcagtgatagtgacagcagtgacagtagtgacagcagcagcagt
gacagcagcgatagtgatagtgacagcaaggacagcacttctgacagcagtgatgacaac
agcaagtctggtaatggcaacagtgacagcgacagtgacagcgacagtgacagcgaaggc
agtgacagtaaccactcaaccagtgatgattag

DBGET integrated database retrieval system