KEGG   Rattus norvegicus (rat): 25259Help
Entry
25259             CDS       T01003                                 

Gene name
Gp5, PLGPV
Definition
(RefSeq) glycoprotein V (platelet)
  KO
K06260  platelet glycoprotein V
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04512  ECM-receptor interaction
rno04611  Platelet activation
rno04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    25259 (Gp5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    25259 (Gp5)
   04611 Platelet activation
    25259 (Gp5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25259 (Gp5)
CD molecules [BR:rno04090]
 Proteins
  25259 (Gp5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRR_1 LRRNT LRRCT
Motif
Other DBs
NCBI-GeneID: 25259
NCBI-ProteinID: NP_036927
RGD: 2724
Ensembl: ENSRNOG00000061705
UniProt: O08770
Position
11q22
AA seq 567 aa AA seqDB search
MLRSVLLSAVLSLVGAQPFPCPKTCKCVVRDAVQCSGGSVAHIAELGLPTNLTHILLFRM
DRGVLQSHSFSGMTVLQRLMLSDSHISAIDPGTFNDLVKLKTLRLTRNKISHLPRAILDK
MVLLEQLFLDHNALRDLDQNLFQKLLNLRDLCLNQNQLSFLPANLFSSLGKLKVLDLSRN
NLTHLPQGLLGAQIKLEKLLLYSNRLMSLDSGLLANLGALTELRLERNHLRSIAPGAFDS
LGNLSTLTLSGNLLESLPPALFLHVSWLTRLTLFENPLEELPEVLFGEMAGLRELWLNGT
HLRTLPAAAFRNLSGLQTLGLTRNPLLSALPPGMFHGLTELRVLAVHTNALEELPEDALR
GLGRLRQVSLRHNRLRALPRTLFRNLSSLVTVQLEHNQLKTLPGDVFAALPQLTRVLLGH
NPWLCDCGLWPFLQWLRHHLELLGRDEPPQCNGPESRASLTFWELLQGDQWCPSSRGLPP
DPPTENALKAPDPTQRPNSSQSWAWVQLVARGESPDNRFYWNLYILLLIAQATIAGFIVF
AMIKIGQLFRTLIREELLFEAMGKSSN
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgctaaggagcgtcctactgtccgcggtgctctcactagtaggcgcccaacccttcccc
tgccccaaaacctgcaagtgtgtggtccgcgatgccgtgcaatgctccggcggcagcgtg
gctcacatcgctgagctaggtctgcccacgaacctcacacacatcctgctcttcagaatg
gaccggggagtattgcagagccacagcttcagcggcatgacggtccttcagcgcctgatg
ctctcagatagccacatttctgccatcgaccccggcaccttcaatgacctggtaaaacta
aaaaccctcaggttgacgcgcaacaaaatctctcatcttccacgtgcgatcctggataag
atggtgcttttggaacagctgttcttggaccacaatgcactaagggaccttgaccaaaac
ctgtttcagaaactgcttaacctgcgggatctctgtttgaaccagaatcagctctccttt
cttcctgctaaccttttctcgagcctgggaaagctgaaggtgttggatttatcgcgaaac
aacctgacccacctgccccagggattacttggggcgcaaattaagcttgagaaactgctg
ctctattcaaaccggctcatgtctctggattcggggctgctggccaacctgggcgccctg
actgagctgcggctggagcggaatcaccttcgctccatcgcaccgggtgccttcgacagc
ctcggaaacctgagcaccttgactctgtccggaaacctcctggagtctctgccgcccgcg
ctcttccttcatgtgagctggctgactcggctgaccctgttcgagaaccctctggaggag
ctcccggaggtgctgttcggggagatggccggcctgcgggagctgtggctgaacggcacc
cacctgcgcacgctgcccgccgccgccttccgcaacctgagcggcctgcagacgctgggg
ctgacacggaacccgctcctgagcgcgctcccgccgggcatgttccacggcctgacggag
ctgcgcgtgctggccgtgcacaccaatgccctggaggagctgccggaggacgcgctgcgc
ggcctcgggcgcctgcgccaggtgtcgctgcgccacaaccggttgcgggccctgccccgc
acgctcttccgtaacctcagcagcctcgtgacggtgcagcttgagcataaccagctgaag
accctgccaggagacgtgttcgcggctctgccccaactgacccgggtcctgctcggtcac
aacccctggctctgcgactgtggcctgtggcccttcctccagtggctgcggcatcacctg
gagctcctaggccgagatgagcctccgcagtgcaatggcccagagtcacgcgccagcctg
acgttctgggagctgctgcagggtgaccagtggtgcccaagttctcgcggtctgcctccc
gaccctccaaccgaaaatgctctgaaagccccggatccgacccagcggcccaatagctcg
cagtcctgggcgtgggtccagctggtggccaggggtgaaagtcccgataaccgcttctac
tggaatctttatattctacttctaatagcccaggccaccatagccgggttcatcgtgttt
gccatgattaaaatcggccagctgtttcgaacattgatcagagaggagctcttgtttgag
gcaatgggaaaatcgtctaactaa

DBGET integrated database retrieval system