KEGG   Rattus norvegicus (rat): 25260Help
Entry
25260             CDS       T01003                                 

Gene name
Gstt1, GSTYRS
Definition
(RefSeq) glutathione S-transferase theta 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    25260 (Gstt1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    25260 (Gstt1)
   00982 Drug metabolism - cytochrome P450
    25260 (Gstt1)
   00983 Drug metabolism - other enzymes
    25260 (Gstt1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25260 (Gstt1)
   05204 Chemical carcinogenesis
    25260 (Gstt1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    25260 (Gstt1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    25260 (Gstt1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    25260 (Gstt1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25260 (Gstt1)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     25260 (Gstt1)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   25260 (Gstt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3 GST_N_4
Motif
Other DBs
NCBI-GeneID: 25260
NCBI-ProteinID: NP_445745
RGD: 2765
Ensembl: ENSRNOG00000049771
UniProt: Q01579 B6DYQ8
Position
20p12
AA seq 240 aa AA seqDB search
MVLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFAQVNPMKKVPAMKDG
GFTLCESVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRTLWHKVMF
PVFLGEQIRPEMLAATLADLDVNVQVLEDQFLQDKDFLVGPHISLADVVAITELMHPVGG
GCPVFEGRPRLAAWYRRVEAAVGKDLFLEAHEVILKVRDCPPADPVIKQKLMPRVLTMIQ
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggtcctggaactgtacctggatctgctgtcgcagccctgtcgcgctatttatatcttc
gccaagaagaacaatatcccgttccagatgcatactgtggagctgcgcaagggtgagcac
ctcagcgatgcctttgcccaggtgaaccccatgaagaaggtaccagccatgaaggatggt
ggcttcaccttgtgtgagagtgtggccatcctgctctacctggcgcacaagtataaggtt
cctgaccactggtacccccaagacctgcaggcccgtgctcgtgtggatgagtacctggca
tggcagcatacgacccttcggagaagctgtctccggaccctgtggcataaggtgatgttc
cccgttttcctgggtgagcagatacgcccggagatgctggcagccacattggcagatctg
gatgttaacgtacaggtgctggaagaccagttcctccaggacaaagacttccttgtcgga
ccgcacatctccctggctgacgtggtagctatcacagagctgatgcatcctgtaggtggt
ggctgcccagtctttgaagggcgtcccaggctggctgcatggtacaggagagtggaggca
gctgtggggaaggacctcttcctggaggcccatgaggtcatcctgaaggtgagagactgt
ccacctgctgaccccgtcataaagcaaaagctgatgcccagagtgctgaccatgatccag
tga

DBGET integrated database retrieval system