KEGG   Rattus norvegicus (rat): 25261
Entry
25261             CDS       T01003                                 

Gene name
Id1
Definition
(RefSeq) DNA-binding protein inhibitor ID-1
  KO
K04680  DNA-binding protein inhibitor ID1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    25261 (Id1)
   04350 TGF-beta signaling pathway
    25261 (Id1)
   04390 Hippo signaling pathway
    25261 (Id1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    25261 (Id1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25261 (Id1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    25261 (Id1)
SSDB
Motif
Pfam: HLH Dsl1_N
Other DBs
NCBI-GeneID: 25261
NCBI-ProteinID: NP_036929
RGD: 2858
Ensembl: ENSRNOG00000021750
UniProt: P41135 A0JPJ2
Position
3
AA seq 148 aa
MKVASSSAAATAGPSCSLKAGRTAGEVVLGLSEQSVAISRCAGTRLPALLDEQQVNVLLY
DMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVATAGGRGLPVRA
PLSTLNGEISALAAEAACVPADDRILCR
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaaggtcgccagtagcagtgccgcggccaccgcaggccccagctgttcgctgaaggca
ggcaggacggcgggcgaagtggtgcttggtctgtcggagcaaagcgttgccatctcgcgc
tgcgctgggacgcgcctgcccgccttgctggacgaacagcaggtgaacgttctgctctac
gacatgaacggctgctactcacgcctcaaggagctggtgcctaccctgcctcagaaccgc
aaagtgagcaaggtggagatactgcagcatgttatcgactacatcagggacctgcagctg
gagctgaactctgagtctgaagtcgcgaccgccggaggccgggggctgcccgtccgggcc
ccgctcagcaccctgaacggcgagatcagtgccttggcggccgaggcggcatgtgttcca
gccgacgaccgcatcttgtgtcgctga

KEGG   Rattus norvegicus (rat): 25585
Entry
25585             CDS       T01003                                 

Gene name
Id3
Definition
(RefSeq) DNA-binding protein inhibitor ID-3
  KO
K17694  DNA-binding protein inhibitor ID3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    25585 (Id3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    25585 (Id3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25585 (Id3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    25585 (Id3)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 25585
NCBI-ProteinID: NP_037190
RGD: 2860
Ensembl: ENSRNOG00000026124
UniProt: P41138
Position
5
AA seq 119 aa
MKALSPVRGCYEAVCCLSERSLAIARGRGKSPSAEEPLSLLDDMNHCYSRLRELVPGVPR
GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISKDKRSFCH
NT seq 360 nt   +upstreamnt  +downstreamnt
atgaaggcgctgagcccggtgcgcggctgctacgaggcggtgtgctgcctgtcggaacgt
agcctagccattgcgcgaggccggggtaagagcccgtcggcggaggagccgcttagcctc
ttggacgacatgaaccactgctactcgcgcctgcgggaactggtgccgggagtcccgcgg
ggcactcagcttagccaggtggaaatcctgcagcgtgtcatagactacatcctcgacctt
caagtggttctggcagagcccgcgcctggacccccggatggtccgcatctcccgatccag
acagctgagctcactccggaacttgtgatctccaaggacaagaggagtttttgccactga

KEGG   Rattus norvegicus (rat): 25587
Entry
25587             CDS       T01003                                 

Gene name
Id2
Definition
(RefSeq) DNA-binding protein inhibitor ID-2
  KO
K17693  DNA-binding protein inhibitor ID2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    25587 (Id2)
   04390 Hippo signaling pathway
    25587 (Id2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    25587 (Id2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    25587 (Id2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25587 (Id2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    25587 (Id2)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 25587
NCBI-ProteinID: NP_037192
RGD: 2859
Ensembl: ENSRNOG00000007237
UniProt: P41137
Position
6
AA seq 134 aa
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVT
KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQTSRTPLTTLNTDISILSLQASEF
PSELMSNDSKVLCG
NT seq 405 nt   +upstreamnt  +downstreamnt
atgaaagccttcagtccggtgaggtccgttaggaaaaacagcctgtcggaccacagcttg
ggcatctcccggagcaaaaccccggtggacgacccgatgagtctgctctacaacatgaac
gactgctactccaagctcaaggaactggtgcccagcatcccccagaacaagaaggtgacc
aagatggaaatcctgcagcacgtcatcgattatatcttggacctgcagatcgccctggac
tcgcaccccactatcgtcagcctgcaccaccagagacctggacagaaccaaacgtccagg
acgccgctgaccaccctgaacacggacatcagcatcctgtccttgcaggcgtctgaattc
ccttctgagcttatgtcgaatgacagcaaagtactctgtggctaa

KEGG   Rattus norvegicus (rat): 291023
Entry
291023            CDS       T01003                                 

Gene name
Id4
Definition
(RefSeq) DNA-binding protein inhibitor ID-4
  KO
K17695  DNA-binding protein inhibitor ID4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    291023 (Id4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    291023 (Id4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    291023 (Id4)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    291023 (Id4)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 291023
NCBI-ProteinID: NP_783172
RGD: 631428
Ensembl: ENSRNOG00000016099
UniProt: Q8CH17
Position
17
AA seq 161 aa
MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEP
ALCLQCDMNDCYTRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP
PAPPLHSAGACPVAPQRTPLTALNTDPAGAVNKQGDSILCR
NT seq 486 nt   +upstreamnt  +downstreamnt
atgaaggcggtgagcccggtgcgcccctctggccgcaaggcgccgtcgggctgcggcggc
ggggagctggcgctacgttgcctggcggagcatggccatagcctaggtggctcggcagcc
gcggcggcggcggcggcggcagcgcgctgcaaggcggccgaggcggcggccgacgagccg
gcactgtgcctgcagtgcgatatgaacgactgctacactcgcctgcggaggctcgtgccc
accatcccgcccaacaagaaagtcagcaaagtggagatcctgcagcacgttatcgactac
atcctggacctgcagctggcgctggagacgcaccctgctctgctgagacagccgccaccg
cccgcgccaccgctccactcggccggggcttgcccggtcgcgccgcagcggaccccgctt
acggcgctcaacactgacccggccggcgccgtgaacaagcagggcgacagcattctctgc
cgctga

DBGET integrated database retrieval system