KEGG   Rattus norvegicus (rat): 25262Help
Entry
25262             CDS       T01003                                 

Gene name
Itpr1, I145TR, IP3R1, InsP3R, InsP3R1, P400
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor, type 1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04114  Oocyte meiosis
rno04140  Autophagy - animal
rno04210  Apoptosis
rno04218  Cellular senescence
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04621  NOD-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04918  Thyroid hormone synthesis
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno05010  Alzheimer disease
rno05016  Huntington disease
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    25262 (Itpr1)
   04020 Calcium signaling pathway
    25262 (Itpr1)
   04070 Phosphatidylinositol signaling system
    25262 (Itpr1)
   04022 cGMP-PKG signaling pathway
    25262 (Itpr1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    25262 (Itpr1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    25262 (Itpr1)
   04210 Apoptosis
    25262 (Itpr1)
   04218 Cellular senescence
    25262 (Itpr1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    25262 (Itpr1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    25262 (Itpr1)
   04621 NOD-like receptor signaling pathway
    25262 (Itpr1)
   04625 C-type lectin receptor signaling pathway
    25262 (Itpr1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    25262 (Itpr1)
   04912 GnRH signaling pathway
    25262 (Itpr1)
   04915 Estrogen signaling pathway
    25262 (Itpr1)
   04921 Oxytocin signaling pathway
    25262 (Itpr1)
   04918 Thyroid hormone synthesis
    25262 (Itpr1)
   04928 Parathyroid hormone synthesis, secretion and action
    25262 (Itpr1)
   04924 Renin secretion
    25262 (Itpr1)
   04925 Aldosterone synthesis and secretion
    25262 (Itpr1)
   04927 Cortisol synthesis and secretion
    25262 (Itpr1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    25262 (Itpr1)
  09154 Digestive system
   04970 Salivary secretion
    25262 (Itpr1)
   04971 Gastric acid secretion
    25262 (Itpr1)
   04972 Pancreatic secretion
    25262 (Itpr1)
  09156 Nervous system
   04724 Glutamatergic synapse
    25262 (Itpr1)
   04725 Cholinergic synapse
    25262 (Itpr1)
   04728 Dopaminergic synapse
    25262 (Itpr1)
   04726 Serotonergic synapse
    25262 (Itpr1)
   04720 Long-term potentiation
    25262 (Itpr1)
   04730 Long-term depression
    25262 (Itpr1)
   04723 Retrograde endocannabinoid signaling
    25262 (Itpr1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    25262 (Itpr1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    25262 (Itpr1)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    25262 (Itpr1)
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    25262 (Itpr1)
   05016 Huntington disease
    25262 (Itpr1)
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    25262 (Itpr1)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    25262 (Itpr1)
   05163 Human cytomegalovirus infection
    25262 (Itpr1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    25262 (Itpr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    25262 (Itpr1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    25262 (Itpr1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     25262 (Itpr1)
Ion channels [BR:rno04040]
 Ligand-gated channels
  IP3 receptor
   25262 (Itpr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans MscS_porin
Motif
Other DBs
NCBI-GeneID: 25262
NCBI-ProteinID: NP_001257526
RGD: 2933
Ensembl: ENSRNOG00000007104
UniProt: P29994 C7E1V2 Q5BJS8 A0A0A0MY31
Structure
PDB: 

Position
4q41
AA seq 2709 aa AA seqDB search
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPLKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDAK
EGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRAS
FCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGASKDEIKERFAQTMEFV
EEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHV
TTIFPISKMTKGEENKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPEGNVKQAEP
EKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQSSETSSGNSSQEG
PSNVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGAL
QLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPD
EPMDGASGENEHKKTEEGTSKPLKHESTSSYNYRVVKEILIRLSKLCVQESASVRKSRKQ
QQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHIN
LFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEG
KFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLMYHIHLVEL
LAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEI
YTSNHMWKLFENFLVDICRACNNTSDRKHADSVLEKYVTEIVMSIVTTFFSSPFSDQSTT
LQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNN
LFLKSHNIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQA
ELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLRE
MMTKDRGYGEKGEALRQILVNRYYGNIRPSGRRESLTSFGNGPLSPGGPSKPGGGGGGPG
SGSTSRGEMSLAEVQCHLDKEGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQH
SFFCRLTEDKKSEKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKA
KEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQSGEGTQATTDKAKDDLEMSA
VITIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLL
GLYINEKNVALINQTLESLTEYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKKR
MDLVLELKNNASKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGEN
GEDGAASPRNVGHNIYILAHQLARHNKELQTMLKPGGQVDGDEALEFYAKHTAQIEIVRL
DRTMEQIVFPVPSICEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLR
AQPVLYWCARNMSFWSSISFNLAVLMNLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLISL
AIVIALPKPHGIRALIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTR
GYRAMVLDVEFLYHLLYLLICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSI
ILTAVLALILVYLFSIVGYLFFKDDFILEVDRLPNETAGPETGESLANDFLYSDVCRVET
GENCTSPAPKEELLPVEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEP
LFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKF
DNKTVTFEEHIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIRERNLDWFPRMRAM
SLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPH
MNVNPQQPA
NT seq 8130 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaaatgtctagtttcctacatatcggagacatttgttctctgtatgcagag
ggatctacgaatggatttatcagcaccttgggcttggttgatgaccgttgcgttgtacag
ccagaagctggggaccttaacaatccacccaagaaattcagagactgcctctttaagcta
tgtcctatgaatcgatattctgcacagaagcagttctggaaagctgctaagcccggggcc
aacagtacaacagatgcggtgctgctcaacaaattgcatcatgctgcagacttggaaaag
aagcagaatgagacagaaaacaggaaattgctggggacggtcatccagtatggcaacgtg
atccagctcctacatttgaaaagcaataaatacttaactgtgaataagaggcttcctgcc
ctgctggagaagaacgccatgagagtgacgttggatgaggctggaaatgaagggtcttgg
ttttacattcagccgttctacaagctccgctccatcggagacagtgtggtcataggtgac
aaggtagttttgaaccctgtcaatgctgggcagccgctacatgccagcagccatcagctg
gtggataacccgggctgcaatgaggtcaactccgtcaactgtaacacaagctggaaaata
gtgcttttcatgaaatggagtgataacaaagatgacattctaaaaggaggtgatgtggta
agactcttccatgctgagcaagagaagtttctcacgtgcgatgagcacaggaagaagcag
cacgtcttcctgaggacaaccggcagacagtcagccacgtcggccaccagctccaaagcc
ctgtgggaagtggaggtagtccagcatgacccatgtcggggtggagctgggtactggaat
agcctcttccggttcaagcacctggctacagggcattacttggcagcagaggtagaccct
gactttgaggaagaatgcctggagtttcagccctcagtggaccctgatcaggacgcatct
cggagcaggttgagaaatgcccaagaaaaaatggtgtactctctggtctctgtgcctgag
ggcaacgacatctcctccatctttgagctagaccccacaactctacgtggaggtgacagc
cttgtcccaaggaactcctatgtccggctcagacacctgtgtacaaacacctgggttcac
agcacaaacatccccattgacaaggaagaggaaaaacctgtcatgctgaagattggtacc
tctcccctgaaggaggacaaggaagcttttgccatagtccccgtttctcctgctgaggtt
cgggacctggactttgccaatgatgccagcaaggtgctgggctccatcgctgggaagttg
gaaaagggcaccatcacccagaatgagagaaggtctgtcaccaagctgctggaagacttg
gtttactttgtcacgggtggaacgaactctggccaagacgtgcttgaagtagtcttctct
aagcccaaccgagagcggcagaagctgatgagggaacagaatattctcaagcagatcttc
aagcttttgcaggcccccttcacggactgcggggatggcccaatgcttcggctggaggag
ctgggggaccagcggcacgctcctttcagacacatttgccgactctgctacagggtcctg
agacactcacagcaagactacaggaagaaccaggagtacatagccaagcagtttggcttc
atgcagaagcagattggctatgatgtgctggccgaagacaccatcactgccctgctccac
aacaaccgaaagctcctggaaaagcacatcaccgcagcagagattgacacgtttgtcagc
ctggtgcgaaagaacagggagcccaggttcttggattacctctctgacctctgtgtatcc
atgaataagtcaatccctgtgacccaggagctcatttgtaaagctgtgctgaatcccacc
aatgctgacatcctgattgagaccaagttggttctttctcgttttgagtttgaaggcgtt
tccaccggagagaatgctctggaagctggggaagatgaggaagaggtgtggctgttctgg
agggacagcaacaaagagatccgtagcaagagtgttagggaattggcacaagatgctaaa
gagggacagaaggaagacagggatgtcctcagctactacaggtatcagctgaacctcttt
gcaaggatgtgtctggaccgccagtacctggccatcaatgaaatatccgggcagctggat
gttgacctcatcctccgctgcatgtccgatgagaacctcccctatgacctcagagcatcc
ttttgccgcctcatgcttcacatgcatgtggaccgagatccccaggagcaggtgacccct
gtgaaatacgcccgtctgtggtcagaaattccctccgagatcgccattgacgactatgac
agcagtggagcatcgaaggatgaaatcaaggagaggtttgctcagacgatggagtttgtg
gaggagtacctgagagatgtggtttgtcaaagattccccttttctgataaggagaaaaat
aagctcacatttgaggttgtgaacttagccaggaacctcatatactttggcttctacaac
ttttctgaccttctccgattaaccaagatcctcttggcaatcttagactgtgttcatgtg
acaaccatcttccccattagcaagatgacgaaaggcgaagagaataaaggcagcaacgtg
atgagatctatccatggagttggggagctcatgacccaggtggtgcttcggggaggaggc
tttttgcccatgactcctatggctgctgcccctgaaggaaatgtgaagcaggcagagcca
gagaaagaggatatcatggtcatggacaccaagttaaagatcattgaaatactccagttt
attttgaatgtgagattggattataggatctcctgcctcctgtgtatatttaagcgggag
tttgatgaaagcaattcccagtcatcagaaacatcctccggaaacagcagccaagaaggg
ccaagtaatgtaccaggtgctcttgactttgaacacattgaagagcaagcagaaggcatc
tttgggggaagtgaggagaacacacctctggacttggatgatcatggtggcagaaccttc
ctcagggtcctgctccacttgacaatgcatgattacccacccctggtgtctggggccctg
cagctcctcttccggcatttcagccagaggcaggaggtccttcaggccttcaaacaggtt
caactgctggttactagccaagatgtggacaactacaaacagatcaagcaagacttggac
cagctaagatccatcgtggagaagtctgagctctgggtatacaaaggccagggtcccgat
gagcctatggacggagcctctggtgaaaacgaacataagaaaactgaggaggggaccagt
aagccactgaagcacgaaagcaccagcagctacaactaccgagtggtgaaagagattctg
attcgacttagcaagctctgtgttcaagagagcgcgtcggtgaggaagagcaggaagcag
cagcagcgactgctgaggaacatgggtgcccatgctgtggtgctggagctgctgcagatc
ccctatgagaaggccgaagataccaagatgcaggagatcatgaggctggctcacgaattt
ctgcagaatttctgcgcaggcaaccagcagaaccaagctttgctacataaacacataaac
ctgtttctcaacccagggatcctggaagcagtgaccatgcagcacatcttcatgaacaac
ttccagctgtgcagtgagatcaacgagagagtggtccagcatttcgttcactgcatagag
acccacggtcgaaatgtccagtatatcaagtttctccagactattgtcaaggccgaaggg
aaattcattaaaaagtgccaagacatggtcatggctgagcttgtcaattctggagaggac
gtcctcgtgttctacaatgacagagcctctttccagactctgatccagatgatgcggtcc
gagcgtgaccggatggatgagaacagccctctcatgtaccacatccatctggtggagctc
ttggctgtgtgcacagagggcaagaatgtgtacacagagatcaagtgcaactccctgctc
ccgctcgatgacatcgttcgtgtggtcactcatgaagactgtatccccgaggttaagatt
gcttacatcaacttcctgaatcactgctatgtggacactgaggtggagatgaaggagatt
tacacaagtaatcacatgtggaagttgtttgagaatttcctcgtggacatctgcagggcc
tgtaacaacacaagtgacaggaagcatgcagactcggttctggagaagtacgtcactgaa
atcgtgatgagcattgtcaccaccttcttcagctctcccttctcagaccagagtaccact
ctgcagactcgccagcctgtctttgtgcagctcctgcaaggcgtgttccgagtttaccac
tgcaactggttgatgccgagccagaaagcctcggtggagagctgtatccgcgtgctctct
gacgtagccaagagccgggccatagccattcctgttgacctagacagccaagtcaacaac
ctcttcctgaagtcccacaacattgtgcagaaaacagccatgaactggcggttatcagcc
cgcaacgctgctcgtagagactctgtcctggcagcttccagagactaccgaaatattatt
gagaggttacaggacatcgtgtctgccctggaggaccgactcaggcccctggtccaggcc
gagctgtctgtgctcgtggatgttctacacagaccggaactgcttttccctgagaacacg
gatgccaggaggaaatgcgaaagtggaggtttcatctgcaagctcataaaacacaccaag
cagctgctagaggagaatgaagagaaactgtgcattaaagtcttacagaccctcagggaa
atgatgaccaaagatagaggctatggagaaaagggtgaggcactccggcaaattttggtc
aaccgttactatggaaacatcagaccttcaggaagaagagagagccttaccagctttggc
aatggtccactatcaccaggaggacccagcaagcctgggggaggagggggaggtcctggg
tccggctccacaagccggggtgagatgagcctggctgaggttcaatgtcatctcgacaag
gaaggcgcctccaatctggtcatcgacctcataatgaatgcatccagcgaccgagtattc
cacgaaagcattctcctggccatcgcacttctggaaggaggcaacaccactatccagcac
tcatttttctgccggctgacggaagataagaaatcagagaagttcttcaaggtcttttac
gatcgaatgaaggtggcccagcaggaaatcaaggcgacagtgaccgtgaacaccagcgat
ttgggaaacaaaaagaaagatgatgaagtggaccgggatgccccatcccggaagaaagcc
aaagagcccacaacacagataacagaagaggtccgggatcagctcttggaagcatctgct
gccaccagaaaagcctttaccaccttccggagggaggccgaccctgatgaccattaccaa
tctggggagggcacccaggctacaacggacaaagccaaggatgacctagagatgagtgca
gtcatcaccatcatgcagcctatcctgcgcttcctgcagctcctgtgtgaaaaccacaac
cgcgatctgcagaatttccttcgttgccaaaataataagaccaactacaacttggtgtgt
gagacactgcagtttctggactgtatctgtgggagcacaactggaggccttggtcttctc
ggactgtacataaatgaaaagaatgtagctcttatcaaccaaaccctggagagtctgact
gagtactgtcaagggccttgccatgaaaaccagaactgcatcgccacccacgagtccaat
ggcatcgatatcatcacagccctcatccttaacgatatcaaccctctggggaagaaacgg
atggacctggtgttagaactgaagaacaatgcttcaaagctactcctggccatcatggaa
agcagacacgatagtgaaaatgcagagaggatcctgtacaacatgaggcccaaggagctg
gtggaagtgatcaagaaggcctacatgcaaggcgaagtggagtttgaggatggggagaac
ggtgaggatggagcagcctcccccaggaacgtgggccataacatctacatcctcgctcac
cagttggctcggcataacaaagaacttcaaaccatgctgaaacctggaggccaggtggat
ggcgatgaagctctggagttctatgcgaagcacacagcacaaattgagattgtcagactg
gaccgaactatggaacagattgtcttccctgtgcccagcatctgtgaatttctgactaag
gaatcgaaacttcgaatatattacaccacagagagggatgagcaaggcagcaagatcaat
gacttcttcctgcgctccgaggacctctttaatgagatgaactggcagaagaaacttcga
gcccagcctgtcttgtactggtgcgcccgaaacatgtctttctggagcagcatctccttc
aacctggccgtcctgatgaacctgctggtggcgtttttctacccatttaaaggagtgaga
ggaggaacactagagccgcactggtccggcctcctgtggacagccatgctcatctctctg
gcaattgtcattgcgctgcccaagccccatggcatccgggccttaattgcttctacaatc
ctacgactgatattttcagttggattacagcccacactgtttctgctgggagctttcaat
gtctgcaataaaatcatcttcctgatgagctttgtgggcaactgtgggaccttcaccaga
ggctaccgagccatggttctggacgttgagttcctctatcatttgctgtatctactgatc
tgtgccatgggcctcttcgtacatgagtttttctatagtttgctgctttttgatttagtg
tacagagaggagactttgcttaatgtcattaaaagtgtcacccgcaatggacggtccatc
atcttgacagcggtcctggctctgattctggtttacctgttctcaattgtgggctacctg
ttcttcaaggatgactttatcttggaagtagacaggttgcccaatgagacagctggtcca
gaaactggtgagagtttggccaacgatttcctgtactctgatgtgtgccgggtagagacg
ggggagaactgcacctctccggcacccaaagaagagctgctccctgtggaagaaacggaa
caggataaggagcacacgtgtgagacactgctcatgtgcatcgtcaccgttctgagtcac
gggctgcggagtgggggcggagtaggagatgtgctcaggaagccatccaaagaggagcct
ctgtttgctgcaagggtgatctatgacctcctcttcttcttcatggtcatcatcattgtc
ctgaacctcatttttggggtcatcatcgacacctttgctgacctgaggagtgagaagcag
aagaaggaagagatcttaaaaaccacgtgcttcatttgtggcttggaaagggacaagttt
gacaataagaccgtcacctttgaagagcacattaaggaagaacacaacatgtggcactat
ctgtgcttcatcgtgctggtgaaagtgaaggactccaccgagtacaccgggcccgagagc
tacgtggcagagatgatcagggaaagaaaccttgattggttccccaggatgagagccatg
tccctggtcagcagtgactctgaaggggaacagaacgagctgaggaacctgcaggagaag
ctggagtccaccatgaagctggtcaccaatctttctggccagctgtcagaactaaaggac
cagatgacagaacaaaggaagcagaaacaaagaattggccttctaggacatcctcctcac
atgaatgtcaacccacagcagccagcctaa

DBGET integrated database retrieval system