KEGG   Rattus norvegicus (rat): 25263
Entry
25263             CDS       T01003                                 

Gene name
Mal, MALGENE
Definition
(RefSeq) mal, T-cell differentiation protein
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: MARVEL
Other DBs
NCBI-GeneID: 25263
NCBI-ProteinID: NP_036930
RGD: 3037
Ensembl: ENSRNOG00000015445
UniProt: Q64349
Position
3q36
AA seq 153 aa
MAPAAASGGSTLPSGFSVFVTFPDLLFIFEFIFGGLVWILIASSLVPMPLVQGWVMFVSV
FCFLATTSLMVMYIIGTHGGETSWITLDAAYHCVAALFYLSASVLEALATITMFDGFTYR
HYHENIAAVVFAYVATLLYVIHAVFSLIRWKSS
NT seq 462 nt   +upstreamnt  +downstreamnt
atggccccagcagcagcttcgggtggcagcaccctgcccagtggcttctccgtcttcgtc
accttccctgacttgctcttcatctttgagtttatctttggaggcctggtgtggatcctg
atcgcctcctccctggtacccatgcccctggtccagggctgggtgatgtttgtgtctgtg
ttctgcttcctggccaccacttccctgatggtcatgtacataattggtactcatggtggg
gagacttcctggatcacactggatgcagcctaccactgtgtggctgccctgttttacctc
agtgcctcagtcctggaagccctggccaccatcacaatgttcgatggctttacctacagg
cattaccatgagaacatcgctgcagtggtgttcgcctatgtggctactctgctctacgtg
atccatgctgtgttttccttaatcagatggaagtcttcatag

DBGET integrated database retrieval system