KEGG   Rattus norvegicus (rat): 25264Help
Entry
25264             CDS       T01003                                 

Gene name
Nmbr, NMB-R
Definition
(RefSeq) neuromedin B receptor
  KO
K04168  neuromedin B receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25264 (Nmbr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25264 (Nmbr)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Bombesin
    25264 (Nmbr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srsx 7TM_GPCR_Srw
Motif
Other DBs
NCBI-GeneID: 25264
NCBI-ProteinID: NP_036931
RGD: 3181
UniProt: P24053
Position
1p13
AA seq 390 aa AA seqDB search
MPPRSLPNLSLPTEASESELEPEVWENDFLPDSDGTTAELVIRCVIPSLYLIIISVGLLG
NIMLVKIFLTNSTMRSVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWVFGKLGCKLIP
AIQLTSVGVSVFTLTALSADRYRAIVNPMDMQTSGVVLWTSLKAVGIWVVSVLLAVPEAV
FSEVARIGSSDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLVIISIYYYHIAKTLI
RSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFVFCWFPNHILYLYRSFNYKEIDPSL
GHMIVTLVARVLSFSNSCVNPFALYLLSESFRKHFNSQLCCGQKSYPERSTSYLLSSSAV
RMTSLKSNAKNVVTNSVLLNGHSTKQEIAL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgccccccaggtctctccccaacctctccttgcccaccgaggcgagcgagagcgagttg
gaacccgaggtgtgggaaaatgatttcctgcctgactcagacgggaccaccgcggagttg
gtaatccgctgtgtgataccatccctctacctaatcatcatctcggtgggcttgctgggc
aacatcatgctggtgaagatattcctcaccaacagcaccatgcggagtgtccccaacatc
ttcatctctaacctggctgcgggagacctgctgctgctgctgacctgcgtcccagtggat
gcctcccgatacttctttgatgaatgggtgttcggcaagctgggctgcaaactcatccca
gccatccagctcacctcggtgggggtttccgtgttcactctcacggccctcagcgctgac
aggtacagagctatcgtgaaccccatggacatgcagacgtctggtgtggtgctgtggacc
agtttgaaggccgtgggcatctgggtggtctctgtgctgttggctgtccctgaggctgtg
ttttcggaagtagcacgcatcggtagctcggataacagcagtttcacagcatgcataccc
tacccacaaacagatgagttacatccaaagatccactcagtgctcatttttcttgtctat
ttcctcataccccttgttatcatcagcatttattattatcacattgcgaagactttaatt
agaagtgcacacaatcttcctggagaatacaatgaacataccaaaaagcagatggagaca
cggaaacgcctggccaagatcgttctggtgtttgtgggctgctttgtcttctgctggttt
cccaaccacatcctctacttgtataggtctttcaactacaaggagatcgatccttctctt
ggacacatgattgtcaccttagtggcccgggttctgagtttcagcaactcctgtgtcaac
ccgtttgctctttacctgctcagtgaaagcttcaggaagcatttcaacagccagctctgt
tgtgggcagaagtcctatcctgagaggtctaccagctacctcctcagctcttcagcagta
agaatgacttctctgaaaagcaacgcgaagaatgtggtgaccaattctgtcctgctcaac
ggacatagcacaaagcaagaaatagcactgtga

DBGET integrated database retrieval system