KEGG   Rattus norvegicus (rat): 25270Help
Entry
25270             CDS       T01003                                 

Gene name
Abcd3, PMP70, Pxmp1
Definition
(RefSeq) ATP binding cassette subfamily D member 3
  KO
K05677  ATP-binding cassette, subfamily D (ALD), member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno02010  ABC transporters
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    25270 (Abcd3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    25270 (Abcd3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25270 (Abcd3)
Transporters [BR:rno02000]
 ABC Transporters, Eukaryotic Type
  ABCD (ALD) subfamily
   ABCD3 subgroup
    25270 (Abcd3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane_2 ABC_tran AAA_23 SMC_N AAA_21 AAA_29 Rad17 Lon_2 AAA_27 IstB_IS21 AAA_16 AAA_5
Motif
Other DBs
NCBI-GeneID: 25270
NCBI-ProteinID: NP_036936
RGD: 2007
Ensembl: ENSRNOG00000011929
UniProt: P16970
Position
2q41
AA seq 659 aa AA seqDB search
MAAFSKYLTARNSSLAGAAFLLFCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVD
KVFLSRLSQILKIMVPRTFCKETGYLILIAVMLVSRTYCDVWMIQNGTLIESGIIGRSSK
DFKRYLFNFIAAMPLISLVNNFLKYGLNELKLCFRVRLTRYLYEEYLQAFTYYKMGNLDN
RIANPDQLLTQDVEKFCNSVVDLYSNLSKPFLDIVLYIFKLTSAIGAQGPASMMAYLLVS
GLFLTRLRRPIGKMTIMEQKYEGEYRFVNSRLITNSEEIAFYNGNKREKQTIHSVFRKLV
EHLHNFIFFRFSMGFIDSIIAKYIATVVGYLVVSRPFLDLAHPRHLHSTHSELLEDYYQS
GRMLLRMSQALGRIVLAGREMTRLAGFTARITELMQVLKDLNHGKYERTMVSQQDKGIEG
AQASPLIPGAGEIINADNIIKFDHVPLATPNGDILIQDLSFEVRSGANVLICGPNGCGKS
SLFRVLGELWPLFGGHLTKPERGKLFYVPQRPYMTLGTLRDQVIYPDGKEDQKKKGISDQ
VLKGYLDNVQLGHILEREGGWDSVQDWMDVLSGGEKQRMAMARLFYHKPQFAILDECTSA
VSVDVEDYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKKITEDTVEFGS
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggcggccttcagcaagtacttgacggcgcggaactcctcgctggcgggggccgcgttc
ctgctgttctgcctgctccacaagcggcgtcgcgccctcggcctgcacggtaagaaaagt
ggaaaaccgccattacagaataatgagaaagaaggaaagaaagagcgagctgtggtggac
aaagtgtttttatcaaggctctcacagatcctaaaaattatggtccctagaacattttgt
aaagagacagggtacttgatacttattgctgttatgctggtatctcgaacatactgtgat
gtttggatgattcaaaatggcacactgattgaaagtggcatcattggtcgtagcagtaaa
gatttcaagagatacttattcaacttcatcgctgccatgcctcttatctctctggttaat
aacttcttgaagtatgggttaaatgagctcaaactgtgcttccgtgtgcggctcactaga
tacctctatgaggagtatctccaagccttcacctactataaaatgggcaacctggataac
agaatagcaaacccagaccagctgcttacacaagatgtagaaaagttttgtaacagtgta
gttgatctttattcgaatcttagtaagccatttttagacatagttttgtatattttcaag
ttaacaagtgcaattggagctcagggcccggcaagcatgatggcctacttgcttgtttct
gggctattcctaactcgactcagaagacccatcggtaaaatgacgattatggagcagaag
tatgaaggagaatatagattcgttaattcacggcttatcactaatagtgaagaaattgcc
ttttacaatgggaataaacgagaaaagcagacaatccactctgtcttccgaaaactggtg
gaacacctacataatttcattttcttccggttttctatgggtttcattgatagcatcatt
gccaaatatattgccactgtagttgggtacctggttgtcagtcgcccgttcctagacctg
gcgcatccgcgacaccttcacagcacccactcagagctgctggaggattactaccaaagt
ggaagaatgcttttgagaatgtctcaagctttggggcggatagttttggctgggcgtgaa
atgactagattggctggttttacggctcggattacggaattaatgcaagtactaaaggat
ttaaatcatggcaaatatgaacgtacaatggtgtcacaacaggataagggtattgaagga
gcacaagctagtcccttgatacctggtgctggagaaatcatcaatgcagacaacattata
aagtttgatcatgttcctttagcaacaccaaatggagatatcttgatccaagaccttagt
tttgaagttcgatctggggccaacgttctcatttgtggtccaaatggctgtggaaagagc
tccctcttccgtgttcttggtgaattatggcctctctttggaggacatcttactaaacct
gagagaggaaagttattttatgttcctcagcgaccctatatgaccctgggaacactgaga
gaccaagtaatatatccagatggaaaggaggatcagaagaagaaggggatatctgaccaa
gtgctgaaggggtacttggacaatgtacagttgggccatatccttgagcgggaaggaggc
tgggacagtgttcaggactggatggatgtactcagcggaggagaaaaacaaagaatggcg
atggcaagattgttttatcataaaccccagtttgccattctggatgagtgcacaagtgca
gttagtgtggatgtggaagactacatttacagccactgtcggaaggttggcatcaccctc
ttcactgtctcacacaggaaatccctttggaaacaccacgagtactacctgcacatggat
ggcagaggcaattatgaattcaaaaagatcacagaagacacagttgagttcggatcatag

DBGET integrated database retrieval system