KEGG   Rattus norvegicus (rat): 25276Help
Entry
25276             CDS       T01003                                 

Gene name
Sycp1, SCP1
Definition
(RefSeq) synaptonemal complex protein 1
  KO
K19533  synaptonemal complex protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    25276 (Sycp1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Meiosis-specific sister chromatid cohesion proteins
   Synaptonemal complex
    25276 (Sycp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SCP-1 DUF16
Motif
Other DBs
NCBI-GeneID: 25276
NCBI-ProteinID: NP_036942
RGD: 3794
Ensembl: ENSRNOG00000016835
UniProt: Q03410
Position
2q34
AA seq 946 aa AA seqDB search
MSSLSKNRENIDTDPAFQKLSILPMLEQVANSGSCHYQEGVNDSDFENSEPMSRLYSKLY
KEAEKIKKWKVSIESELKQKENKLQENRKIIEAQRKAIQELQFENEKVSLKLEEEIQENK
DLIKENNATRHWCNLLKETCARSAEKTSKYEYEREETRQVYVDLNNNIEKMILAFEELRV
QAENARLEMHFKLKEDHEKIQHLEEEYQKEVNNKENQVSLLLIQSTEKENKMKDLTFLLE
ESRDKANQLEEKTKLQDENLKELNEKKDHLTSELEDIKMSMQRSMSTQKTLEEDLQIATK
TIYQLTEEKEAQMEELNKAKTTHSLVVTELKATTCTLEELLRTEQQRLENNEDQLKLITM
ELQKKSSELEEMTKFKNNKEVELEELKTILAEDQKLLDEKKQVEKLAEELQGKEQELTFL
LQTREKEIHDLEVQVTVTKTSEEHYLKQVEEMKTELEKEKLKNIELTANSDMLLLENKKL
VQEASDMVLELKKHQEDIINCKKQEERMLKQIETLEEKEMNLRDELESVRKEFIQQGDEV
KCKLDKSEENARSIEYEVLKKEKQMKILENKCNNLKKQIENKSKNIEELHQENKALKKKS
SAENKQLNAYEIKVNKLELELASTKQKFEEMINNYQKEIEIKKISEEKLLGEVEKAKATV
DEAVKLQKEIDLRCQHKIAEMVALMEKHKHQYDKIVEERDSELGLYKNREQEQSSAKVAL
ETELSNIRNELVSLKKQLEVEKEEKEKLKMEQENTAILTDKKDKKIQASLLESPEATSWK
FDSKTTPSQNISRLSSSMDSGKSKDNRDSLRASAKSILSTTVTKEYTVKTPTKKSIYQRE
NKYLPTGGSNKKRKTVFEFDVNSDSSETTDLLSLVSEEDISNRIYNNNTPDSHLLVKTPK
QTPLSLSTPASFTKFGSLKKMREDRWATIAKIDRKRRLKEAEKLFT
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtctatcaaaaaatcgggaaaacattgatacagatcccgcttttcaaaaactt
agcattttgcccatgcttgaacaggttgcaaattctggcagttgccactatcaggaagga
gtaaatgactctgattttgagaattcagagccaatgagcagactgtactcaaagctgtat
aaagaggctgaaaagataaaaaagtggaaagtgagcatagagtctgaactgaagcagaaa
gaaaataagttgcaagaaaacagaaagataattgaagcccagcgaaaagccattcaggaa
cttcagtttgaaaatgaaaaagtaagcttgaaattagaagaagaaattcaagaaaataaa
gatttaatcaaggagaataatgctacaagacattggtgtaatttactcaaggaaacctgt
gctagatctgcagaaaagacaagtaaatatgaatatgagcgagaagaaaccagacaagtt
tatgtggatctaaataataacattgagaaaatgatactagcttttgaggaacttcgtgtg
caagctgagaatgccaggctggaaatgcactttaagttaaaggaagatcatgaaaaaatc
caacatcttgaagaagaatatcagaaggaagtaaacaacaaggaaaaccaggtatcacta
ctattgatccaaagtactgagaaagaaaataaaatgaaagatttaacatttctgctagag
gaatccagagataaagctaatcaattagaggaaaaaacaaaattacaagatgaaaactta
aaagaattaaatgaaaagaaggatcatttaacatcagaacttgaagatattaaaatgtcc
atgcaaagaagtatgagcactcagaagactttagaggaagatttacagatagcaacaaaa
acgatttatcagctcactgaagaaaaagaagctcaaatggaagaactcaacaaagctaaa
actactcactcacttgtggtgactgaacttaaagccactacatgtaccttggaggaatta
ctgagaacagaacagcaaagattggaaaataatgaggatcaactgaaactgattactatg
gagctccagaagaaatcaagtgaactagaagagatgactaaatttaaaaataacaaagaa
gtggaacttgaagaattaaaaaccatattggcagaagaccaaaaacttttagatgaaaag
aaacaagttgagaagcttgctgaagaattacaagggaaagaacaagaactaactttcctt
ttgcaaaccagagagaaagaaatccatgatttggaagtacaagtaactgtcactaaaaca
agtgaagaacattatttaaaacaggttgaagaaatgaaaactgagcttgaaaaagagaaa
cttaagaatattgaattaactgcaaactctgacatgcttttgcttgagaacaaaaaattg
gtacaagaagcaagtgatatggtcctagaactcaagaaacatcaagaagatatcattaat
tgcaaaaagcaagaagaaaggatgttgaaacaaatagaaactttggaagaaaaagaaatg
aatttaagggatgaactggaatcagtaagaaaagagttcatacagcaaggagatgaagtt
aaatgtaaattggacaagagtgaagaaaatgctcgaagcattgaatatgaagttttaaag
aaagaaaagcagatgaagatattagaaaataagtgtaataatttaaagaaacaaatcgaa
aataaaagcaagaatattgaagagcttcaccaggagaataaagccttgaaaaaaaaaagt
tcagcagaaaacaaacaactgaatgcatatgagataaaggtcaataaattagagttggaa
ttagcaagtaccaagcaaaaatttgaagaaatgattaacaactaccagaaagaaattgag
ataaaaaagatttcagaagaaaagcttttgggagaggttgagaaagccaaagcaacagtt
gatgaagccgtaaagttacagaaagaaattgatttacgatgccaacataaaatagctgag
atggtagcacttatggaaaaacataagcaccaatatgataagattgttgaagaaagagac
tcagaattaggactttataaaaacagagaacaggaacagtcttcagcaaaggttgctttg
gagactgaattatctaatatcagaaacgaacttgtatcccttaagaagcaacttgaagta
gaaaaagaagaaaaagagaaattaaaaatggaacaagaaaacacagctattctcacagat
aaaaaagacaagaaaatacaggcatctttgctggaatcacctgaagccactagttggaaa
tttgattctaaaacaactccctcacaaaatatatctcggctttcctcatcaatggatagt
ggcaaatccaaagataacagagatagtctgcgggcatctgccaaaagcattttatctaca
acagttacaaaggaatatacagtgaagacaccaactaaaaagagcatatatcaaagagaa
aacaagtatttacctactggaggaagtaataaaaagagaaaaactgtctttgaatttgat
gttaattcagatagttcagaaactactgatcttttgagcttggtttcagaggaagatata
tcaaacaggatttataataataatacaccagattctcatctattagtcaaaactcccaaa
cagactcctttatctttatcaactcctgcatcttttacgaagtttggaagtctgaaaaaa
atgagagaagaccgttgggcaacgattgctaaaattgataggaaaagaagactaaaggaa
gcagaaaagttatttacttaa

DBGET integrated database retrieval system