KEGG   Rattus norvegicus (rat): 25277Help
Entry
25277             CDS       T01003                                 

Gene name
Mfge8, AGS, MFGME8, MFGMP-E8, OAcGD3S
Definition
(RefSeq) milk fat globule-EGF factor 8 protein
  KO
K17253  lactadherin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25277 (Mfge8)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   25277 (Mfge8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F5_F8_type_C EGF Muskelin_N hEGF EGF_2 EGF_3
Motif
Other DBs
NCBI-GeneID: 25277
NCBI-ProteinID: NP_036943
RGD: 3083
Ensembl: ENSRNOG00000017510
UniProt: P70490
Position
1q31
AA seq 427 aa AA seqDB search
MQFSRVLAALCGVLLCASGLFAASGDFCDSSLCLNGGTCLMGQDNDIYCLCPEGFTGLVC
NETEKGPCSPNPCFHDAKCLVTEDTQRGDIFTEYICQCPVGYSGIHCELGCSTKLGLEGG
AIADSQISASSVYMGFMGLQRWGPELARLYRTGIVNAWTASSYDSKPWIQVDFLRKMRVS
GVMTQGASRAGRAEYLKTFKVAYSLDGRRFEFIQDESGTGDKEFMGNQDNNSLKINMFNP
TLEAQYIRLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNTIPDSQITASSSYKTWNLR
AFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQKKVTGIITQGARDFGHIQYVAS
YKVAHSDDGVQWTVYEEQGTSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPLSWHNRITL
RLELLGC
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcagttctcccgtgtgctggccgcgctgtgcggtgtgctgctctgcgcctccggcctc
ttcgctgcgtccggtgacttctgtgactccagcctgtgcctgaatggtgggacctgcttg
atgggccaagacaatgacatctactgcctctgccctgaaggcttcacaggccttgtgtgc
aacgagactgagaaaggaccgtgttccccaaacccttgcttccacgatgccaaatgcctg
gtgactgaggacacacagcgaggggacatcttcactgagtacatctgccagtgccctgtg
ggctactcgggcatccactgtgaactcggctgttccacaaagctgggcttggaagggggc
gccattgccgattcacagatttctgcctcgtctgtgtatatgggcttcatgggcttgcag
cgctggggcccggagctggctcgcctgtatcgcacagggattgtcaatgcatggacagcc
agcagctatgatagcaagccctggatccaggtggactttctgcggaagatgcgggtatca
ggtgtgatgacacagggtgccagccgtgccgggagggcggaatacctgaagaccttcaag
gtggcttacagcctcgatggacgcaggttcgagttcatccaggatgaaagcggaaccgga
gacaaggagtttatgggtaaccaggacaacaacagcctgaagattaacatgttcaacccc
actctggaggcacagtacataaggctgtaccctgtctcgtgccaccgcggctgcaccctc
cgcttcgagctcctgggctgcgagttgcatggatgctctgagcccctgggcctgaagaat
aacacgattcctgacagccaaataacagcctccagcagctacaagacgtggaacctgcgt
gcctttggctggtacccccacttggggcggctggacaatcagggcaagatcaatgcctgg
acagctcagagcaacagtgccaaggaatggctgcaggttgacctgggcactcagaaaaaa
gtgacaggaattatcacccagggggcccgtgactttggccacatccagtatgtggcatcc
tataaggtagcccacagtgatgatggtgtgcagtggaccgtatatgaggaacaaggaacc
agcaaggtcttccagggcaacttggacaacaactcccacaagaagaacatctttgagaaa
cctttcatggctcgctatgtgcgtgtccttccactgtcctggcataaccgtatcaccctg
cgcctggagctgctgggctgttag

DBGET integrated database retrieval system