KEGG   Rattus norvegicus (rat): 25278
Entry
25278             CDS       T01003                                 

Gene name
Cox6a2, COX6AH
Definition
(RefSeq) cytochrome c oxidase subunit 6A2
  KO
K02266  cytochrome c oxidase subunit 6a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    25278 (Cox6a2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    25278 (Cox6a2)
  09159 Environmental adaptation
   04714 Thermogenesis
    25278 (Cox6a2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    25278 (Cox6a2)
   05012 Parkinson disease
    25278 (Cox6a2)
   05014 Amyotrophic lateral sclerosis
    25278 (Cox6a2)
   05016 Huntington disease
    25278 (Cox6a2)
   05020 Prion disease
    25278 (Cox6a2)
   05022 Pathways of neurodegeneration - multiple diseases
    25278 (Cox6a2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    25278 (Cox6a2)
SSDB
Motif
Pfam: COX6A
Other DBs
NCBI-GeneID: 25278
NCBI-ProteinID: NP_036944
RGD: 2385
Ensembl: ENSRNOG00000019851
UniProt: G3V8M4
Position
1q37
AA seq 97 aa
MALPLKVLSRSMASASKGDHGGAGANTWRLLTFVLALPSVALCSLNCWMHAGHHERPEFI
PYHHLRIRTKPFSWGDGNHTLFHNPHVNPLPTGYEQP
NT seq 294 nt   +upstreamnt  +downstreamnt
atggctctgcctcttaaggtcctcagtcggagcatggccagcgcatccaaaggagaccac
ggaggcgcaggagccaacacttggcgcctcctgacctttgtgctggctctccccagcgta
gctctctgctcgcttaactgctggatgcacgctggccaccatgagcgcccagaattcatc
ccctatcaccacctccgcatccgaaccaagcccttctcctggggggatgggaaccacacg
cttttccacaatccccacgtcaatcctttgcccaccggctacgagcagccttga

DBGET integrated database retrieval system