KEGG   Rattus norvegicus (rat): 25280
Entry
25280             CDS       T01003                                 

Gene name
St8sia1
Definition
(RefSeq) alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
  KO
K03371  alpha-N-acetyl-neuraminate alpha-2,8-sialyltransferase (sialyltransferase 8A) [EC:2.4.99.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00601  Glycosphingolipid biosynthesis - lacto and neolacto series
rno00603  Glycosphingolipid biosynthesis - globo and isoglobo series
rno00604  Glycosphingolipid biosynthesis - ganglio series
rno01100  Metabolic pathways
Module
rno_M00069  Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    25280 (St8sia1)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    25280 (St8sia1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    25280 (St8sia1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    25280 (St8sia1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.8  alpha-N-acetylneuraminate alpha-2,8-sialyltransferase
     25280 (St8sia1)
Glycosyltransferases [BR:rno01003]
 Terminal extension
  Sialyltransferase
   25280 (St8sia1)
SSDB
Motif
Pfam: Glyco_transf_29
Other DBs
NCBI-GeneID: 25280
NCBI-ProteinID: NP_036945
RGD: 3679
Ensembl: ENSRNOG00000014018
UniProt: G3V7T2
Position
4
AA seq 356 aa
MSPCGRALHTSRGAMAMLARKFPRTRLPVGASALCVVVLCWLYVFPVYRLPNEKEIVQGV
LAQRTAWRRNQTSARLFRKQMEDCCNPAHLFAMTKVNSPMGKSLWYDGEFLYSLTIDNST
YSLFPQATPFQLPLKKCAVVGNGGILKMSGCGRQIDEANFVMRCNLPPLSSEYTRDVGSK
TQLVTANPSIIRQRFENLLWSRKKFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLKD
AGANQTVLFANPNFLRNIGKFWKGRGIHAKRLSTGLFLVSAALGLCEEVSIYGFWPFSVN
MQGEPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKMGALRMQLDPCEEPSPPQPTS
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgagcccctgcgggcgggccctacatacatccagaggggccatggccatgctggcgcgg
aaattcccgcgtacccggctacccgtgggagccagtgccctctgtgtggtggtcctctgt
tggctctatgtcttccctgtctaccggctgcccaacgagaaggagatcgtgcaaggagtg
ctggcgcagcgcacagcttggaggaggaaccagacgtcagccaggctcttcaggaaacaa
atggaagactgctgcaaccccgcccatctctttgcaatgacgaaggtgaactcccccatg
gggaagagcctgtggtatgacggggagtttctatactcgctcaccatcgacaactccacg
tactccctcttcccccaggcaacccccttccagctgccattgaagaaatgtgcggtggtg
ggaaacggtgggattctgaagatgagtggctgtggccgtcaaatagatgaagcaaatttt
gtcatgcggtgtaaccttcctcccttgtcaagtgaatacaccagagatgtgggttccaag
actcagttggtgacagctaaccccagcataattcgccagagatttgaaaacctgctgtgg
tccagaaagaagtttgtggacaacatgaagatctataaccacagttacatatacatgcct
gccttttctatgaagacgggaacagagccgtctctccgtgtgtactacaccctgaaagac
gctggagccaatcaaacagtgctttttgctaaccccaactttcttcgaaacattggaaag
ttctggaagggtagggggatccatgccaagcgcctgtctacaggactctttttggtgagt
gcagccttgggcctttgtgaggaggtgtccatctacggcttctggcccttctccgtgaac
atgcaaggggaacctatcagccaccattactatgacaacgtcttgcccttctcaggcttc
catgccatgcccgaggagtttcttcaactctggtatcttcataaaatgggtgcactgagg
atgcaactggacccatgtgaggagccgtcgccgccacagcccacttcctag

DBGET integrated database retrieval system