KEGG   Rattus norvegicus (rat): 25281Help
Entry
25281             CDS       T01003                                 

Gene name
Nup153, NUCZINK
Definition
(RefSeq) nucleoporin 153
  KO
K14296  nuclear pore complex protein Nup153
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    25281 (Nup153)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     25281 (Nup153)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nup153 zf-RanBP Nup_retrotrp_bd
Motif
Other DBs
NCBI-GeneID: 25281
NCBI-ProteinID: NP_001093940
RGD: 3216
Ensembl: ENSRNOG00000001456
UniProt: G3V662
Structure
PDB: 

Position
17p14
AA seq 1468 aa AA seqDB search
MASGAGGIGGGGGGGKIRTRRCHQGPVKPYQQGRPQHQGILSRVTESVKNIVPGWLQRYF
NKSENACSCSVNADEVPRWPENREDEREIYVDENTNTDDGRTTPEPTGSNTEEPSTTSTA
SNYPDVLTRPSLHRSHLNFSVLESPALHCQPSTSSAFPIGSSGFSLVKEIKDSTSQHDDD
NISTTSGFSSRASEKDIAVSKNTSLPPLWSPEAERSHSLSQHTAISSKKPAFNLSAFGTL
STSLGNSSILKTSQLGDSPFYPGKTTYGGAAAAVRQNKVRSTPYQAPVRRQMKAKQLNAQ
SYGVTSSTARRILQSLEKMSSPLADAKRIPSAVSSPLNSPLDRSGIDSTVFQAKKEKVDS
QYPPVQRLMTPKPVSIATNRTVYFKPSLTPSGDLRKTNQRIDKKNSTVDEKNISRQNREQ
ESGFSYPNFSIPAANGLSSGVGGGGGKMRRERTTHFVASKPSEEEEVEVPLLPQISLPIS
SSSLPTFNFSSPAISAASSSSVSPSQPLSNKVQMTSLGSTGNPVFTFSSPIVKSTQADVL
PPASIGFTFSVPLAKTELSGPNSSSETVLSSSVTAQDNTVVNSSSSKKRSAPCEDPFTPA
KILREGSVLDILKTPGFMSPKVDSPALQPTTTSSIVYTRPAISTFSSSGVEFGESLKAGS
SWQCDTCLLQNKVTDNKCIACQAAKLPLKETAKQTGIGTPSKSDKPASTSGTGFGDKFKP
AIGTWDCDTCLVQNKPEAVKCVACETPKPGTGVKRALPLTVASESPVTASSSTTVTTGTL
GFGDKFKRPVGSWECPVCCVSNKAEDSRCVSCTSEKPGLVSASSSNPVPVSLPSGGCLGL
DKFKKPEGSWDCEVCLVQNKADSTKCIACESAKPGTKSEFKGFGTSSSLNPAPSAFKFGI
PSSSSGLSQTFTSTGNFKFGDQGGFKLGTSSDSGSTNTMNTNFKFPKPTGDFKFGVLPDS
KPEEIKNDSKNDNFQFGPSSGLSNPASSAPFQFGVSTLGQQEKKEELPQSSSAGFSFGAG
VANPSSAAIDTTVTSENKSGFNFGTIDTKSVSVTPFTYKTTEAKKEDASATKGGFTFGKV
DSAALSSPSMFVLGRTEEKQQEPVTSTSLVFGKKADNEEPKCQPVFSFGNSEQTKDESSS
KPTFSFSVAKPSVKESDQLAKATFAFGNQTNTTTDQGAAKPAFSFLNSSSSSSSTPATSS
SASIFGSSTSSSSPPVAAFVFGQASNPVSSSAFGNSAESSTSQPLLFPQDGKPATTSSTA
SAAPPFVFGTGASSNSTVSSGFTFGATTTSSSSGSFFVFGTGHSAPSASPAFGANQTPTF
GQSQGASQPNPPSFGSISSSTALFSAGSQPVPPPTFGTVSSSSQPPVFGQQPSQSAFGSG
TANASSVFQFGSSTTNFNFTNNNPSGVFTFGASPSTPAAAAQPSGSGGFSFSQSPASFTV
GSNGKNMFSSSGTSVSGRKIKTAVRRKK
NT seq 4407 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaggagccggaggcataggagggggcggcggcggcggcaagatccggacgcgt
cgttgccaccaggggccggtgaagccttaccagcaggggcgaccccaacaccagggcatt
cttagcagggttacagaatctgttaagaatattgtaccagggtggctacagagatacttc
aacaagagtgaaaatgcctgtagctgttcagtaaatgcagatgaagttccacgttggccg
gaaaatagagaagatgagcgtgagatttatgtggatgagaacacaaacactgatgacggg
agaaccacccctgagcccacaggcagtaacacagaagaaccatcaaccaccagtactgct
tcaaattatccagatgtattaacaagaccttctcttcatcggagtcatctgaatttctcc
gtgttagaatcccctgctttgcactgtcagccatccacgtcctctgcattcccaatcggc
agttctggattttcccttgtgaaggagattaaagattctacctctcagcatgatgatgat
aacatctcaactaccagtgggttctcttcaagagcttctgagaaagatatagctgtttca
aagaacacttccctgccacctttgtggtcccccgaagcagagcgttctcattcactctca
caacatactgccatcagctccaaaaaaccagcattcaacttgtctgcctttggaacactt
tccacctcacttgggaattcttcaattcttaaaacaagtcaacttggagactctcctttt
tatcctggcaaaacaacatatggtggggcagctgctgctgtaagacagaataaagtacga
agtacaccttaccaggctccagttcgaagacagatgaaagccaagcagctcaatgcacag
tcttatggtgtgaccagttcaacagcacggcggatattgcagtcattagaaaagatgtca
agccctcttgcggatgcaaaaagaattccatctgctgtttcttctcctctgaattctccc
cttgataggagtgggatagatagcacagtttttcaggcaaaaaaggaaaaggtggactct
cagtatccccctgttcagagactaatgaccccaaagccagtttccatagcaacaaataga
actgtctattttaaaccatctctgaccccatctggtgacttaaggaagactaatcaaagg
atagataaaaagaacagtactgtagatgaaaaaaatatctcaagacaaaatagagagcaa
gaaagtggcttttcataccccaatttcagtattcctgcagccaatggtttatcttctgga
gtaggtggtggaggtggcaagatgagaagagagagaacaacacattttgttgcttctaaa
ccttcagaggaggaggaagtagaagtaccattgttaccgcaaatctctctaccaatcagc
agttcttcactgcccaccttcaactttagttcccctgcgatctcggctgcttcttcgtca
tcagtcagcccttctcagccattatcaaacaaggtacagatgacctctctgggcagcaca
ggcaatcccgtgttcaccttttcctctcccattgtgaagtccacgcaggcagacgtgcta
cctccagcatctattggatttacgtttagtgtgcctcttgcaaaaacagaactttctggc
cctaatagttcttcagaaacagttttaagtagttcagttacagctcaagataacactgta
gtgaatagttcaagctctaagaagcgaagtgccccttgtgaggacccttttacacctgca
aagatcctgagagaaggaagtgttttagacattctgaaaacgcctggtttcatgtcacca
aaggttgattctcctgctcttcagcccacaactacaagctcaatagtttatacaagacca
gcaataagtactttttcttctagtggggttgagtttggagaaagtttaaaagctggatca
tcatggcagtgtgacacatgtctactccagaacaaagtcacagacaataagtgtatagcc
tgtcaagcagcaaaactgccactgaaagaaactgctaaacagactggaattgggacacca
agcaaaagtgacaagccagcttctacatcagggacaggttttggagataaatttaaacca
gcaataggaacttgggattgtgatacctgtttagtgcaaaataagcctgaagcagtaaaa
tgtgtagcctgtgaaacacccaaacctggcactggtgtgaagcgagcccttccattgacg
gtggcttcagaaagtcctgtgactgcttcctcttctaccaccgtgaccactggtacacta
ggatttggagataaattcaaaaggcccgtgggatcttgggagtgtccggtatgctgtgtt
tctaataaggcagaagacagcagatgtgtctcctgtacatctgagaaaccaggtttggta
tctgcctcaagcagcaaccctgtccctgtctctctgccttctggaggctgtttaggattg
gacaagtttaaaaaaccagagggaagctgggactgtgaagtatgcctagtgcaaaataaa
gcggactctaccaagtgcatagcttgtgaaagtgcaaagccaggcacaaagtctgagttt
aaaggctttgggacatcttcatctttaaatccagcaccctcagccttcaaatttggtatt
ccatcatcatcttctgggctttctcaaacttttacaagcactggaaattttaaatttgga
gatcagggaggattcaaattaggcacttcatctgactctgggtctacaaacaccatgaat
acaaactttaaatttcctaaaccaactggagattttaaatttggagtattacctgattcc
aaacctgaagaaataaaaaacgacagcaagaatgataattttcagtttggaccttcttct
ggcttaagcaatccagcgtcttcagctccatttcagtttggggtatctactcttgggcag
caggaaaagaaagaggagctgcctcagtcttcatctgcaggcttcagttttggtgcaggt
gttgctaacccctctagtgctgctattgacaccacagtgacctcagagaacaagagcggc
ttcaactttggaaccatagacactaagagtgtctcagtgactcctttcacgtacaagaca
acagaagcaaagaaagaagacgcgtctgctaccaagggtgggttcacatttggtaaagtg
gactctgctgctttgtcatctccctcaatgtttgtgttgggaaggacagaggagaaacag
caagaacctgttacttctacttctctggtatttggaaagaaagctgacaatgaggagcca
aagtgtcaaccagtattttcctttggaaattcagagcaaaccaaagacgagagttcctcc
aagccgaccttcagtttcagtgtggcaaaaccatctgtgaaggagtctgatcagctggcc
aaggctacttttgcatttggaaatcaaaccaatacaacaactgatcaaggtgcagcaaag
ccagcttttagcttcttgaacagcagttcctctagttcaagtacgccggccacttcatcc
agtgctagcatatttggtagttccacctcttcctccagcccgcctgtggcagcctttgtg
tttggacaggccagtaatcctgtcagcagctctgccttcggaaactccgccgagtccagt
acatctcagcctttgctctttcctcaagatggcaaaccagccaccacgtccagcactgcc
tcagctgcccctccatttgtatttggaacaggagccagtagtaatagtactgtatcttct
gggttcacttttggggctacaaccacatcaagctcttcaggatccttctttgtatttggc
actggacattcagcaccatctgccagtccagcatttggtgctaaccagactccaacattt
ggacaaagtcaaggtgccagccagcctaaccctccaagctttggctctatatcgtcttca
acagcattattttctgctggttctcagcctgtaccaccacctacatttgggacagtgtca
agcagcagccaacctcctgtgtttggacagcagcctagtcagtctgcatttggctctggg
acagccaatgctagttcggttttccagtttggcagcagcactacaaatttcaacttcaca
aacaataatccatcaggagtgttcacatttggtgcaagtcccagcacgcctgcagccgca
gcccagccctcaggttcggggggcttttcattcagccagtctccagcatcatttacagtg
gggtcaaatgggaaaaatatgttctcttcttccggaacttcagtttctggtcgcaagata
aagactgctgttagacgcaagaaataa

DBGET integrated database retrieval system