KEGG   Rattus norvegicus (rat): 25283
Entry
25283             CDS       T01003                                 

Gene name
Gclc, Glclc
Definition
(RefSeq) glutamate-cysteine ligase, catalytic subunit
  KO
K11204  glutamate--cysteine ligase catalytic subunit [EC:6.3.2.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00270  Cysteine and methionine metabolism
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
rno04216  Ferroptosis
Module
rno_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    25283 (Gclc)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    25283 (Gclc)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    25283 (Gclc)
Enzymes [BR:rno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.2  glutamate---cysteine ligase
     25283 (Gclc)
SSDB
Motif
Pfam: GCS GCS2
Other DBs
NCBI-GeneID: 25283
NCBI-ProteinID: NP_036947
RGD: 619868
Ensembl: ENSRNOG00000006302
UniProt: P19468
Position
8q31
AA seq 637 aa
MGLLSQGSPLSWEETQRHADHVRRHGILQFLHIYHAVKDRHKDVLKWGDEVEYMLVSFDH
ENRKVQLLLNGGDVLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTV
EDNMRKRRKEATSVLGEHQALCTITSFPRLGCPGFTLPEHRPNPEEGGASKSLFFPDEAI
NKHPRFGTLTRNIRHRRGEKVVINVPIFKDKNTPSPFVETFPEDEEASKASKPDHIYMDA
MGFGMGNCCLQVTFQACSISEARYLYDQLATICPIVMALSAASPFYRGYVSDIDCRWGVI
SASVDDRTREERGLEPLKNNRFKISKSRYDSIDSYLSKCGEKYNDIDLTIDTEIYEQLLE
EGIDHLLAQHVAHLFIRDPLTLFEEKIHLDDANESDHFENIQSTNWQTMRFKPPPPNSDI
GWRVEFRPMEVQLTDFENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQERDAVL
QGMFYFRKDICKGGNAVVDGCSKAQTSSEPSAEEYTLMSIDTIINGKEGVFPGLIPILNS
YLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEINYS
LILKCNQIANELCECPELLGSGFRKAKYSGGKSDPSD
NT seq 1914 nt   +upstreamnt  +downstreamnt
atggggctgctgtcccaaggctcgccactgagctgggaagagacccagcgccacgccgac
cacgtgcggagacacggcatcctccagttcctgcacatctaccacgcagtcaaggaccgg
cacaaggacgtgctcaagtggggtgacgaggtggagtacatgttggtgtcctttgatcat
gaaaataggaaagtccagttgttactgaatggcggcgatgttcttgaaactctgcaagag
aagggggagaggacaaaccccaaccacccaaccctctggagaccagagtatgggagttac
atgattgaagggacacctggccagccgtacggaggaacgatgtccgagttcaacacagtg
gaggacaacatgaggaaacgccggaaggaggctacttctgtattaggagaacatcaggct
ctttgcacgataacttcatttcccaggctaggctgccctggattcacactgccagagcac
agacccaacccagaggaaggaggtgcatctaagtccctcttctttccagacgaagccata
aacaagcacccccgctttggtactctaacaagaaacatccggcatcggagaggagaaaag
gttgtcatcaatgtgccaatattcaaggacaagaacacaccatctccgtttgtagaaaca
tttcctgaggatgaggaggcatcaaaggcctctaagccagaccacatctacatggatgcc
atgggatttgggatgggcaactgctgtcttcaggtgacattccaagcctgcagtatatct
gaggcaagatacctttatgaccagttggccactatctgcccaattgttatggctttgagt
gctgcatcgccattttaccgaggctacgtgtcagacattgattgtcgctggggagtgatt
tctgcatctgtagatgatagaacacgggaggagagaggactggagcccctgaagaacaat
cgctttaaaatcagtaagtctcggtatgactcaatagatagctacctgtccaagtgtgga
gagaagtacaatgacatcgacctgaccatcgacacggagatctacgagcagctcttagag
gaaggcatcgatcaccttctggcacagcacgttgctcatctctttattagagacccactg
accctttttgaagagaaaattcatctggatgatgccaacgagtctgaccattttgagaat
attcagtccacaaactggcagacaatgaggtttaagcctcctcctccaaactcagatatt
ggatggagagtagagttccgaccaatggaggtacagttgacagactttgagaactctgcc
tatgtggtatttgtggtactgctgaccagggtgatcctctcatacaaactagacttcctc
attccactgtccaaggttgacgagaacatgaaagtggcacaggagcgagatgccgtctta
caggggatgttttatttcaggaaagacatttgcaaaggtggcaacgccgtggtggatggg
tgtagcaaggcccagaccagctccgagccatctgcagaggagtacacgctcatgagcata
gacaccatcatcaatgggaaggaaggcgtgtttcctggactcatccccattctgaactcc
taccttgaaaacatggaagtcgacgtggacacccgatgcagtattctgaactacctgaag
ctaattaagaagagagcatctggagaactaatgactgttgccaggtggatgagagagttt
attgcaaaccatcctgactacaagcaagacagtgtaataactgatgagatcaactatagc
ctcattttgaaatgcaatcaaattgcaaatgaattgtgtgaatgtccagagttacttgga
tcaggctttagaaaagcgaagtacagtggaggtaaaagcgacccttcagactag

DBGET integrated database retrieval system