KEGG   Rattus norvegicus (rat): 252833Help
Entry
252833            CDS       T01003                                 

Gene name
Gdf7
Definition
(RefSeq) growth differentiation factor 7
  KO
K20013  growth differentiation factor 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04360  Axon guidance
rno04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    252833 (Gdf7)
   04390 Hippo signaling pathway
    252833 (Gdf7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    252833 (Gdf7)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    252833 (Gdf7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    252833 (Gdf7)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   252833 (Gdf7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta TGFb_propeptide
Motif
Other DBs
NCBI-GeneID: 252833
NCBI-ProteinID: NP_001163821
RGD: 620105
Ensembl: ENSRNOG00000006046
UniProt: F1MAE8
Position
6q14
AA seq 449 aa AA seqDB search
MDLSAAAALCLWLLSACRPRDGLEAAAVLRAAGAGPAWSPGGGGGGRTLAPAPGPSALQA
AAVPGPRAVRRAAGSGFRNGSVVPHHFMMSLYRSLAGRAPAAATSGHGRVDTITGFTDQA
TQGQSFLFDVSSLSDSDEVVNAELRVLRRRSPEPDRDSATLPPLLLLSTCPDEAGTAHLL
HSRAAEPLDSARWEAFDVTDAVQSHRRWPRTSRKFCLVLRAVTGAESSPLALRRLGFGWP
GGGDGGGTAAEERALLVISSRTHRKESLFREIRAQARALRAAAELPPDPGLGAGSRKATP
GGRRRRRTALAGTRGAQGSGGGGGGGGGGGGGGGGAGRGHGRRGRSRCSRKPLHVDFKEL
GWDDWIIAPLDYEAYHCEGVCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLS
PISILYIDAANNVVYKQYEDMVVEACGCR
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggacctgagcgctgccgccgcgctgtgtctctggctgctgagcgcttgccgtccccgc
gacgggctggaagctgccgcggtgctccgagcggcgggagcaggaccagcctggagcccg
gggggcggcggcggcgggcggaccctcgccccagctccaggcccttcagctctccaggcc
gctgcggttcccggtccccgcgctgtgcgccgcgccgcgggctccggcttcaggaacggc
tcggtggtgccacaccacttcatgatgtcgctttaccggagcctggcggggagggctcct
gccgcggcaacttcagggcacgggcgcgtggacacgatcaccggcttcacagaccaagca
actcaaggccagagcttcttattcgacgtatccagcctctcggactccgacgaggtggtg
aatgccgagctgcgcgtgctgcgccggaggtctccggagccagacagggacagtgcgacc
ctccctccgctgctgctgctgtccacgtgcccggacgaggccggcacagctcacttgctg
cactcgcgggccgccgagcccctagacagcgcgcgctgggaagcgttcgacgtgacggac
gcggtgcagagtcaccgccgctggccgcgcacctcccgcaagttctgcctggtgctgcgc
gcggtgacgggcgccgagagcagcccgctggccctgagaagactgggcttcggctggcct
ggcggtggcgacggcggcggcacggcagccgaggagcgcgcgctgttggtgatctcctcc
cgcacgcacaggaaagagagtctgttccgggagatacgcgcccaggcccgcgctctccgg
gccgccgcagagctgccaccagatccaggactaggcgctggatctcggaaagccaccccg
ggcggtcgcaggcggcgacggaccgcgctggctgggactcggggagcgcagggaagcggt
ggcggcggtgggggcggtggcggcggcggcggcggcggcggtggcgcaggcaggggccac
gggcgcagaggcaggagccgctgcagtcgcaagccactgcatgtggactttaaggagctg
ggctgggacgactggatcatcgcgccattagactacgaggcataccactgcgagggcgtt
tgcgactttcctctgcgctcgcacctggagcctaccaaccacgccatcatccagacgctg
ctcaactccatggcgccggatgcggcgccagcctcctgctgcgtgcccgcacgtctcagc
cccatcagcatcctctacatcgacgccgccaacaacgtggtctacaagcagtacgaggac
atggtggtagaggcctgcggctgcaggtag

DBGET integrated database retrieval system