KEGG   Rattus norvegicus (rat): 252833
Entry
252833            CDS       T01003                                 

Gene name
Gdf7
Definition
(RefSeq) growth/differentiation factor 7 precursor
  KO
K20013  growth differentiation factor 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04360  Axon guidance
rno04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    252833 (Gdf7)
   04390 Hippo signaling pathway
    252833 (Gdf7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    252833 (Gdf7)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    252833 (Gdf7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    252833 (Gdf7)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   252833 (Gdf7)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 252833
NCBI-ProteinID: NP_001163821
RGD: 620105
Ensembl: ENSRNOG00000006046
UniProt: F1MAE8
Position
6
AA seq 449 aa
MDLSAAAALCLWLLSACRPRDGLEAAAVLRAAGAGPAWSPGGGGGGRTLAPAPGPSALQA
AAVPGPRAVRRAAGSGFRNGSVVPHHFMMSLYRSLAGRAPAAATSGHGRVDTITGFTDQA
TQGQSFLFDVSSLSDSDEVVNAELRVLRRRSPEPDRDSATLPPLLLLSTCPDEAGTAHLL
HSRAAEPLDSARWEAFDVTDAVQSHRRWPRTSRKFCLVLRAVTGAESSPLALRRLGFGWP
GGGDGGGTAAEERALLVISSRTHRKESLFREIRAQARALRAAAELPPDPGLGAGSRKATP
GGRRRRRTALAGTRGAQGSGGGGGGGGGGGGGGGGAGRGHGRRGRSRCSRKPLHVDFKEL
GWDDWIIAPLDYEAYHCEGVCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLS
PISILYIDAANNVVYKQYEDMVVEACGCR
NT seq 1350 nt   +upstreamnt  +downstreamnt
atggacctgagcgctgccgccgcgctgtgtctctggctgctgagcgcttgccgtccccgc
gacgggctggaagctgccgcggtgctccgagcggcgggagcaggaccagcctggagcccg
gggggcggcggcggcgggcggaccctcgccccagctccaggcccttcagctctccaggcc
gctgcggttcccggtccccgcgctgtgcgccgcgccgcgggctccggcttcaggaacggc
tcggtggtgccacaccacttcatgatgtcgctttaccggagcctggcggggagggctcct
gccgcggcaacttcagggcacgggcgcgtggacacgatcaccggcttcacagaccaagca
actcaaggccagagcttcttattcgacgtatccagcctctcggactccgacgaggtggtg
aatgccgagctgcgcgtgctgcgccggaggtctccggagccagacagggacagtgcgacc
ctccctccgctgctgctgctgtccacgtgcccggacgaggccggcacagctcacttgctg
cactcgcgggccgccgagcccctagacagcgcgcgctgggaagcgttcgacgtgacggac
gcggtgcagagtcaccgccgctggccgcgcacctcccgcaagttctgcctggtgctgcgc
gcggtgacgggcgccgagagcagcccgctggccctgagaagactgggcttcggctggcct
ggcggtggcgacggcggcggcacggcagccgaggagcgcgcgctgttggtgatctcctcc
cgcacgcacaggaaagagagtctgttccgggagatacgcgcccaggcccgcgctctccgg
gccgccgcagagctgccaccagatccaggactaggcgctggatctcggaaagccaccccg
ggcggtcgcaggcggcgacggaccgcgctggctgggactcggggagcgcagggaagcggt
ggcggcggtgggggcggtggcggcggcggcggcggcggcggtggcgcaggcaggggccac
gggcgcagaggcaggagccgctgcagtcgcaagccactgcatgtggactttaaggagctg
ggctgggacgactggatcatcgcgccattagactacgaggcataccactgcgagggcgtt
tgcgactttcctctgcgctcgcacctggagcctaccaaccacgccatcatccagacgctg
ctcaactccatggcgccggatgcggcgccagcctcctgctgcgtgcccgcacgtctcagc
cccatcagcatcctctacatcgacgccgccaacaacgtggtctacaagcagtacgaggac
atggtggtagaggcctgcggctgcaggtag

KEGG   Rattus norvegicus (rat): 252834
Entry
252834            CDS       T01003                                 

Gene name
Gdf6
Definition
(RefSeq) growth/differentiation factor 6 precursor
  KO
K20012  growth differentiation factor 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    252834 (Gdf6)
   04390 Hippo signaling pathway
    252834 (Gdf6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    252834 (Gdf6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    252834 (Gdf6)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   252834 (Gdf6)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 252834
NCBI-ProteinID: NP_001013056
RGD: 620104
Ensembl: ENSRNOG00000007810
Vega: OTTRNOG00000000815
UniProt: Q6HA10
Position
5
AA seq 452 aa
MDTPRVLLWAIFLISFLWDLPGFQQASISSSSSTELDSTKDVENRKGGKMQRTPQESAEG
RTPKEHRPRPNELRRRLPGQSLGQEPPGRGPRVVPHEYMLSIYRTYSIAEKLGINASFFQ
SSKSANTITSFVDRGLDDLSHTPLRRQKYLFDVSTLSDKEELVGAELRLYRQAPPTPWGP
QTRPLHLQLFPCLSPLLLDSRTLDPQGPTEAGWEVFDVWQVLRPQPWKQLCLELRAVWGE
LDARDSGARPRGPQQSPPLDLRSLGFGRRVRPPQERALLVVFTRSQRKNLFTEMHEQLGS
AEAAGAEGSWPAPSGAPDAGSWLPSPGRRRRRTALSSRHGKRHGKKSRLRCSRKPLHVNF
KELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPT
KLTPISILYIDAGNNVVYKQYEDMVVESCGCR
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggacactcctagggtccttctctgggcgatcttcctcatcagcttcctctgggatttg
ccgggtttccagcaggcttccatctcctcgtcctcctccaccgaattggactccaccaag
gacgtggagaaccgcaagggagggaagatgcagcggactccccaagagagtgccgagggc
cggacgcccaaggagcaccggccgcggccgaatgagctcaggcggcgactgccgggacaa
tctctggggcaggagccgccgggcagggggccgcgcgtggtgcctcacgagtacatgctg
tcaatctacaggacttactccattgccgagaagctgggcatcaatgccagctttttccag
tcttccaagtcagctaatacgatcactagctttgtagacagaggactggacgatctctcg
cacactcctctccggagacagaagtatttgtttgatgtgtccacgctctcagacaaagaa
gagctggtgggcgcagagctgaggctttatcgccaggcgcccccaacgccctgggggcca
caaacccgaccgctgcatttgcagctcttcccctgtttgtccccattgttactggactct
aggaccctggatcctcaggggccaacagaagctggctgggaagttttcgacgtgtggcag
gtcctgcgccctcagccgtggaagcagctgtgcttggagcttcgggcagtctggggtgag
ctggacgccagggattcaggagcgcgcccgaggggtccccaacagtcaccgcccctggac
ctgcggagtctgggcttcggccggagggtgcggccgccccaggagcgcgccctgcttgtc
gtgttcaccagatcgcagcgcaagaacctgttcactgagatgcatgagcagctgggctct
gcagaggctgccggagccgaggggtcatggccagcgccgtcgggcgccccagacgccggg
tcttggctgccctcgcccggccgccggcggcgacgcaccgccctcagcagccgtcacggc
aagcgacacggcaagaagtccaggctgcgctgcagcagaaaacctctgcacgtgaatttt
aaggagttaggctgggacgattggattatcgcgcccctagagtacgaggcctatcactgc
gagggcgtgtgcgactttccgctgcgctcgcacctggagcccaccaaccatgccatcatc
caaacgctgatgaactccatggacccgggctccaccccacccagctgctgtgttcccacc
aaattgactcccatcagcatcctgtacatcgatgcgggcaataatgtggtctacaagcag
tacgaggacatggtggtggagtcctgtggttgtaggtag

KEGG   Rattus norvegicus (rat): 252835
Entry
252835            CDS       T01003                                 

Gene name
Gdf5
Definition
(RefSeq) growth/differentiation factor 5
  KO
K04664  growth differentiation factor 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    252835 (Gdf5)
   04390 Hippo signaling pathway
    252835 (Gdf5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    252835 (Gdf5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    252835 (Gdf5)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   252835 (Gdf5)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 252835
NCBI-ProteinID: XP_003749648
RGD: 620102
Ensembl: ENSRNOG00000050123
UniProt: M0RAY4
Position
3
AA seq 495 aa
MRLPKLLTLLLWHLAWLDLGLVCTVLGAPDLGQRPPGARPGLAKAEAKERPPLTRNIFRP
GGHSYGVGATSARAKGSSGQTQAKKDEPRKVPPRASGSETKPGPSPQTRQAAARTVTPKG
QLSGGKASAKAGSAPSSFLLKKTREPGTPREPKEPFRPPPITPHEYMLSLYRTLSDADRK
GGNSSVKLEAGLANTITSFIDKGQDDRGPVVRKQRYVFDISALEKDGLLGAELRILRKKP
LDVAKPAVPSSGRVAQLKLSSCPSGRQPAALLDVRSVPGLDGSGWEVFDIWKLFRNFKNS
AQLCLELEAWERGRAVDLRGLGFERAARQVHEKALFLVFGRTKKRDLFFNEIKARSGQDD
KTVYEYLFSQRRKRRAPLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEA
FHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVV
YKQYEDMVVESCGCR
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgagactccccaaactcctcactttgttgctttggcacctggcgtggctggacctggga
ctcgtctgcactgtgttgggtgcccctgacttaggccagagacccccaggggccaggcca
gggttggccaaggcggaggccaaggagaggccacctctgactcggaatatctttaggcca
gggggtcacagctatggtgtgggggccaccagtgccagggcaaagggaagctctgggcag
acacaggccaagaaggatgaacccagaaaggtgccccccagagccagtggctctgaaacc
aagccaggaccctctccccagactaggcaggctgcagcccggactgtaaccccaaaagga
cagctttctgggggcaaagcatctgcaaaagcaggatctgcccccagctccttcttgctg
aagaagaccagagagcctgggacccctcgagagcctaaggagccattccgcccgcccccc
atcacaccccacgaatatatgctctcgctgtacaggacgctgtccgatgctgacagaaag
ggaggcaacagcagcgtgaagctggaggctggcctggccaacaccatcaccagctttatt
gacaaagggcaagatgaccgaggccctgtggtcaggaagcagaggtacgtgtttgacatc
agtgccttggagaaggatgggctgttgggggctgaactgcggatcttacggaagaagccc
ttggacgtggccaagccagcggtccccagtagcgggcgggttgcccagctgaagctgtcc
agctgccccagcggccggcagccggcagccttgctggatgtgcgctccgtgccaggcctg
gatggatctggctgggaggtgttcgacatctggaaactcttccgaaattttaagaactca
gcgcagctgtgcctggagctggaggcctgggaacggggccgggccgtggacctccgtggc
ctgggctttgaacgtgctgcccgacaggtccacgagaaagccctgttcctggtgtttggg
cgtactaagaaacgggacctgttctttaatgagattaaggcccgctctggccaggatgac
aagactgtgtatgaatatttgttcagccagaggcggaaacggcgggcaccattggccaat
cgccagggcaagcgacccagcaagaacctcaaggctcgctgcagtcgcaaggccttacat
gttaactttaaggacatgggctgggacgactggatcatcgcacccctagagtatgaggcc
ttccactgcgaaggactgtgtgagttccccttgcgctcccacttggagcccacaaaccat
gcagtcattcagaccctgatgaactctatggaccctgaatccacaccgcctacctgttgc
gtgcctacgcggctgagtcccattagcatcctgttcattgactctgccaacaacgtggta
tataaacagtacgaggacatggtcgtggaatcttgtggctgtaggtag

KEGG   Rattus norvegicus (rat): 25296
Entry
25296             CDS       T01003                                 

Gene name
Bmp4
Definition
(RefSeq) bone morphogenetic protein 4 precursor
  KO
K04662  bone morphogenetic protein 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04919  Thyroid hormone signaling pathway
rno05200  Pathways in cancer
rno05217  Basal cell carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    25296 (Bmp4)
   04390 Hippo signaling pathway
    25296 (Bmp4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25296 (Bmp4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    25296 (Bmp4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    25296 (Bmp4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25296 (Bmp4)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    25296 (Bmp4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    25296 (Bmp4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    25296 (Bmp4)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25296 (Bmp4)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   25296 (Bmp4)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   25296 (Bmp4)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 25296
NCBI-ProteinID: NP_036959
RGD: 2213
Ensembl: ENSRNOG00000009694
UniProt: Q6AYU9
Position
15
AA seq 408 aa
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEAT
LLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQSQGTGLEYPERPASRANTVRS
FHHEEHLENIPGTSESSAFRFFFNLSSIPENEVISSAELRLFREQVDQGPDWEQGFHRIN
IYEVMKPPAEMVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVT
HLHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHTLTRRRAKRSPKHHPQR
SRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTL
VNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgattcctggtaaccgaatgctgatggtcgttttattatgccaagtcctgctaggaggc
gcgagccatgctagtttgatacctgagaccgggaagaaaaaagtcgccgagattcagggc
cacgcgggaggacgccgctcagggcagagccatgagctcctgcgggacttcgaggcgaca
cttctgcagatgtttgggctgcgccgccgtccgcagccgagcaagagcgccgtcatcccg
gattacatgagggatctttaccggctccagtctggggaggaggaggaagaagagcagagc
cagggaaccgggcttgagtaccctgagcgtcctgccagcagagccaacactgtgaggagt
ttccatcacgaagaacatctggagaacatcccagggaccagtgagagctctgcttttcgt
ttcttctttaacctcagcagcatcccagagaatgaggtgatctcctctgcagagctccgg
ctatttcgggagcaggtggaccagggccctgactgggaacagggcttccaccgtataaac
atttatgaggttatgaagcccccagcagaaatggtgcctggacacctcatcacacgacta
ctggacaccagactagtccatcacaatgtgacacggtgggaaactttcgatgtgagccct
gcagtccttcgatggacccgggaaaagcaacccaactatgggctggccattgaggtgact
cacctccaccagacacggacccaccagggccaacatgtcaggattagccgatcgttacct
caagggagtggaaattgggcccaactccggcccctcctggtcacttttggccacgatggc
cggggtcataccttgacccgccggagggccaagcgtagtcccaagcatcacccacagcgc
tccaggaagaagaataagaactgccgtcgccattcgctctacgtggacttcagtgacgtg
ggctggaatgattggatcgtggccccaccgggctaccaggccttctactgccacggggac
tgtccctttccactggcggaccacctcaactcaaccaatcatgccattgtgcagaccctg
gtcaactccgttaattctagcatccctaaggcctgctgtgtccccaccgaactgagcgcc
atttccatgttgtatctggacgagtacgacaaggtggtgttgaaaaattatcaggagatg
gtggtggaggggtgcggatgccgctga

KEGG   Rattus norvegicus (rat): 25378
Entry
25378             CDS       T01003                                 

Gene name
Amh
Definition
(RefSeq) muellerian-inhibiting factor precursor
  KO
K04665  anti-mullerian hormone
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    25378 (Amh)
   04390 Hippo signaling pathway
    25378 (Amh)
   04024 cAMP signaling pathway
    25378 (Amh)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25378 (Amh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    25378 (Amh)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   25378 (Amh)
SSDB
Motif
Pfam: AMH_N TGF_beta
Other DBs
NCBI-GeneID: 25378
NCBI-ProteinID: NP_037034
RGD: 2108
Ensembl: ENSRNOG00000019377
UniProt: P49000
Position
7
AA seq 553 aa
MQGPHLSLLLLLLATMGAVLQADTVEELTNTRGLIFLEDGVWPPSSPPEPLCLVAVRGEG
DTSKASLTVVGGLHSYEHAFLEAVQESRWGPQDLATFGVCSTDSQTTLPALQRLGAWLGE
TGEQQLLVLHLAEVIWEPQLLLKFQEPPPGGASRWEQALLVLYPGPGPQVTVTGAGLQGT
QSLCPTRDTRYLVLTVHFPAGAWSGSGLALTLQPSKEGATLTIAQLQAFLFGSDSRCFTR
MTPTLVLLPPTGPTPQPAHGQLDTVPFPQPGLSLEPEDLPHSADPFLETLTRLVRALRGP
LTRASNTRLALDPGALASFPQGLVNLSDPVALGRLLDGEEPLLLLLSPAAATVGEPMRLH
SPTSAPWAAGLARRVAVELQAAASELRDLPGLPPTAPPLLSRLLALCPNDSRSAGDPLRA
LLLLKALQGLRAEWRGREGRGRAGRSKGTGTDGLCALRELSVDLRAERSVLIPETYQANN
CQGACAWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYTGKLLISLSEEHISAH
HVPNMVATECGCR
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgcaggggccacacctctctctgctgctgctgctgctagcgactatgggggctgtgtta
caggctgacacagttgaagaactgaccaataccaggggcctcatcttccttgaagatggg
gtctggcctcccagcagtccccctgagcctttgtgcctggtggcggtgagaggggaaggg
gacacaagcaaggcttccctgacggtggtggggggcctgcacagctatgagcatgccttc
ctggaggctgtccaagagtctcgctggggacctcaagacctagccaccttcggagtctgc
agtactgactcccagactaccctgcctgcccttcagcgcctcggggcctggctcggagag
actggggaacagcagttgctagtcctacatctggctgaagtgatatgggagcctcagctc
ttgctgaagttccaagagcctccacctgggggagccagccgctgggagcaagccctgtta
gtgctataccctggacctgggccccaggtcacagtcacaggagctggactgcagggcaca
cagagcctctgccctactcgggacacccgctatttggtgctgactgtgcactttccagcg
ggggcctggagcggctcggggctcgccctaacccttcaaccaagcaaagaaggtgccacc
ctgaccatcgctcagctgcaggcctttctgtttggctctgattcccgctgtttcacgcgg
atgactcccaccctagtgctgctgccacccaccgggccgacaccgcagccagcacatggc
cagctggacaccgtgcctttcccgcagcctgggctgtccctggagcctgaggacctgcca
cacagtgctgaccccttcctagagaccctcactcgcttggttcgtgctctgcggggacct
ctgacccgggcctcgaacactcgtctggccctggaccctggtgcgctggccagcttccca
cagggcctggtcaacctttcagaccccgtggcgctgggacgtctgctcgatggggaggaa
cccctattactgctgctgtcacccgctgcggccactgtgggggaacctatgcggctgcac
agccccacatctgctccctgggcagcaggcctggcacgcagggtagcggtagagctgcag
gcagcggcctcggagctgcgggacctcccaggcctgccacccacagcccccccattgctg
tcgcgcctactggcgctgtgccccaacgactcccgcagcgccggggacccgctgcgagcg
ctgctgctgctgaaggcactgcagggcctgcgtgcagagtggcgagggcgggaagggcgc
gggagggcggggcgcagcaaggggacagggacagatgggctgtgcgcgctgcgcgagctg
agcgtggaccttcgagcagagcgctcagtgctcatcccggagacctaccaagccaacaac
tgccaaggcgcctgtgcatggccacagtcggaccgtaacccacggtacgggaaccacgtg
gtgctgctgctaaaaatgcaggcacgcggggccgccctgggtcgcctgccctgctgtgtg
cccactgcctacaccggcaagctgctcatcagcctgtcggaggagcacatcagcgcgcac
cacgtgcccaacatggtggctaccgaatgcggctgccggtga

KEGG   Rattus norvegicus (rat): 25644
Entry
25644             CDS       T01003                                 

Gene name
Bmp6
Definition
(RefSeq) bone morphogenetic protein 6 precursor
  KO
K16620  bone morphogenetic protein 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
rno04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    25644 (Bmp6)
   04390 Hippo signaling pathway
    25644 (Bmp6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25644 (Bmp6)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    25644 (Bmp6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    25644 (Bmp6)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   25644 (Bmp6)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta CoV_nucleocap
Other DBs
NCBI-GeneID: 25644
NCBI-ProteinID: NP_037239
RGD: 2214
Ensembl: ENSRNOG00000013717
UniProt: Q04906
Position
17
AA seq 506 aa
MPGLGRRAQWLCWWWGLLCSCGPPPLRPPLPVAAAAAGGQLLGAGGSPVRAEQPPPQSSS
SGFLYRRLKTHEKREMQKEILSVLGLPHRPRPLHGLQQPQSPVLPQQQQSQQTAREEPPP
GRLKSAPLFMLDLYNSLSKDDEEDGVSEGEGLEPESHGRASSSQLKQPSPGAAHSLNRKS
LLAPGPGGSASPLTSAQDSAFLNDADMVMSFVNLVEYDKEFSPRQRHHKEFKFNLSQIPE
GEAVTAAEFRVYKDCVVGSFKNQTFLISIYQVLQEHQHRDSDLFLLDTRVVWASEEGWLE
FDITATSNLWVVTPQHNMGLQLSVVTRDGLHINPRAAGLVGRDGPYDKQPFMVAFFKVSE
VHVRTTRSASSRRRQQSRNRSTQSQDVSRGSSASDYNSSELKTACKKHELYVSFQDLGWQ
DWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAIS
VLYFDDNSNVILKKYRNMVVRACGCH
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgcccgggctggggcggagggcgcagtggctgtgctggtggtgggggttactgtgcagc
tgcggccccccgccactgcggccccctctgccggtagccgcggccgccgccggggggcag
ctgctgggagccggcgggagccctgtgcgcgccgagcagccaccgccgcaatcctcctct
tcgggcttcctctatcggcggctcaagacccacgagaagcgggagatgcaaaaggagatc
ctgtcggtgttggggctgcctcacaggccgcggcccctgcacggtctccagcagcctcaa
tcccccgtgctcccgcagcagcaacaatcgcaacagacggcccgcgaggagccccctcca
gggcggctgaagtccgctccgctcttcatgctggatctctacaactccctgtccaaggac
gacgaagaggatggggtgtcagagggagagggactggagcccgagtcccacggaagggcc
agctcgtcccagctcaaacagccatctcccggggctgcacactccctgaaccgcaagagt
ctcctggccccgggacccggcggcagtgcgtccccactgaccagcgcgcaggacagcgct
ttcctcaacgacgcggacatggtcatgagctttgtgaacctggtggagtacgacaaggag
ttctccccacgccagcgacaccacaaggagttcaagttcaacttatcccagattcccgag
ggtgaggcagtgacggctgcagagttccgcgtctacaaggactgtgtggtggggagtttt
aaaaaccaaacttttcttatcagcatttaccaagtcttacaggagcatcagcacagagac
tctgacctatttttgttggacacccgggtggtgtgggcctccgaagaaggctggctggaa
ttcgacatcacagcaactagcaatctgtgggtggtgacaccgcagcacaacatgggactc
cagctgagtgtggtgactcgggacggactccacatcaacccccgtgcggcgggcctggtg
ggcagagacggcccttacgacaagcagcccttcatggtggccttcttcaaggtgagcgag
gtccacgtgcgcaccaccaggtcagcctccagtcggcgtcgacagcagagtcgcaatcgg
tccacccagtcgcaggacgtgtcccggggctccagtgcttcagactacaacagcagtgag
ttaaaaacagcttgcaagaagcatgagctttacgtgagcttccaggacctgggatggcag
gactggatcatcgcacccaaaggctacgctgccaactattgtgacggagagtgttccttc
cctctcaatgcacacatgaatgccaccaaccacgccattgtacagaccttggtccacctt
atgaatcccgagtacgtccccaaaccatgctgcgcaccaaccaaactgaatgccatctcg
gttctttacttcgacgacaactccaatgtcatcttgaaaaaatacaggaacatggttgtg
agagcttgtggatgtcattga

KEGG   Rattus norvegicus (rat): 29373
Entry
29373             CDS       T01003                                 

Gene name
Bmp2
Definition
(RefSeq) bone morphogenetic protein 2 precursor
  KO
K21283  bone morphogenetic protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
rno05200  Pathways in cancer
rno05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    29373 (Bmp2)
   04390 Hippo signaling pathway
    29373 (Bmp2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29373 (Bmp2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29373 (Bmp2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    29373 (Bmp2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    29373 (Bmp2)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    29373 (Bmp2)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   29373 (Bmp2)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   29373 (Bmp2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 29373
NCBI-ProteinID: NP_058874
RGD: 2211
Ensembl: ENSRNOG00000021276
UniProt: P49001
Position
3
AA seq 394 aa
MVAGTRCLLVLLLPQVLLGGAAGLIPELGRKKFAGASGRPLSRPSDDVLSEFELRLLSMF
GLKQRPTPSKDVVVPPYMLDLYRRHSGQPGAPAPDHRLERAASRANTVRSFHHEEAIEEL
PEMSGKTSRRFFFNLSSVPTDEFLTSAELQIFREQMQEALGNSSFQHRINIYEIIKPATA
SSKFPVTRLLDTRLVTQNTSQWESFDVTPAVMRWTAQGHTNHGFVVEVAHLEEKPGVSKR
HVRISRSLHQDEHSWSQVRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLY
VDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCV
PTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggtggccgggacccgctgtcttctagtgttgctgcttccccaggtcctcctgggcggc
gcggccggcctcattccggagctgggccgcaagaagttcgccggggcatccggccgcccc
ttgtcccggccttcggacgacgtcctcagcgagtttgagttgaggctgctcagcatgttt
ggcctgaagcagagacccacccccagcaaggacgtcgtggtgcccccctatatgctcgac
ctgtaccgccggcactcgggccagccaggagcgcccgccccagaccaccggctggagagg
gcagccagccgcgccaacaccgtgcgcagcttccatcacgaagaagccatcgaggaactt
ccagaaatgagtgggaaaacgtcccgacgcttcttcttcaatttaagttctgtccctact
gatgagtttctcacatctgcggagctccagatttttcgggaacaaatgcaggaagctttg
ggaaatagtagtttccagcaccgaattaatatttatgaaattataaagcctgccacagcc
agctcaaaatttcctgtgaccagactattggacaccaggttagtgactcagaacacaagt
cagtgggagagctttgatgtcaccccggctgtgatgcgatggacagcacagggacacacc
aaccatgggtttgtggtggaagtggcccacttagaggagaagccaggtgtctccaagaga
catgtgaggattagcaggtctttgcaccaagatgaacacagctggtctcaggtaagacca
ctgctagtgacttttggccacgacggaaaaggacatccactccacaaacgagaaaagcgt
caagccaaacacaaacagcggaagcgtcttaagtccagctgcaaaaggcaccctttgtat
gtggacttcagtgatgtggggtggaatgactggatcgtggcccctccaggctatcatgcc
ttttactgccatggggaatgtccttttcccctggctgatcacctgaactccaccaaccat
gccatagtgcagactctggtaaactctgtgaattccaaaatccctaaggcatgctgtgtc
cccactgagcttagcgcaatctccatgttgtacctagatgaaaacgaaaaggttgtgcta
aaaaactatcaggacatggttgtggagggttgcgggtgtcgctag

KEGG   Rattus norvegicus (rat): 315824
Entry
315824            CDS       T01003                                 

Gene name
Bmp5
Definition
(RefSeq) bone morphogenetic protein 5 precursor
  KO
K04663  bone morphogenetic protein 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    315824 (Bmp5)
   04390 Hippo signaling pathway
    315824 (Bmp5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    315824 (Bmp5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    315824 (Bmp5)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   315824 (Bmp5)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 315824
NCBI-ProteinID: NP_001101638
RGD: 1305979
Position
8
AA seq 454 aa
MHWTVFLLRGIVGFLWSSWVQVGYAKGGLGDNHVHSSFIYRRLRNHERREIQREILSILG
LPHRPRPFSPGKQASSAPLFMLDLYNAMASEENPEESEYLVRVSLAGEAKETRKGYPASP
NGYAHRLHLPPRIPLTTQSPPLASLHDTNFLNDADMVMSFVNLVERDKDFSHQRRHYKEF
RFDLTQIPHGEAVTAAEFRIYKDKSNHRFENETIKISIYQIIKEYTNRDADLFLLDTRKA
QALDVGWLVFDITVTSNHWVINPQNNLGLQLCAETGDGRSINVKSAGLVGRHGPQSKQPF
MVAFFKASEVLLRSVRAASKRKNQNRNKSSSHQDPSRIPSAGDYNTSEQKQACKKHELYV
SFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCA
PTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgcattggactgtatttttacttaggggtattgtgggcttcctctggagcagctgggtt
caagtgggttatgccaaaggaggcttgggagacaatcatgttcactccagttttatttat
agaagactacggaaccacgaaagacgggaaatacagagggaaattctctctattctgggt
ttgcctcacagacccaggcccttttcaccggggaagcaagcatcttctgcacccctcttt
atgctggatctgtacaacgccatggccagcgaagaaaaccctgaggagtcagaatattta
gtgagggtatccctggctggagaggctaaagagacaagaaagggatacccagcctctccc
aatgggtatgcacatcgtctgcacttacctccaaggattcctctgactacccagagccca
cctcttgccagtctacacgataccaattttctgaatgatgctgacatggtcatgagtttt
gtcaacctagttgaaagagacaaagacttttctcatcagagaaggcattacaaagaattt
cggtttgatctgacccaaattccacatggagaagcagtgacggcagctgaattccggatt
tataaggacaaaagcaaccatcggtttgaaaatgaaacaattaagattagcatatatcag
atcatcaaggaatacacaaatagggacgcagatctttttctgctagatacaaggaaggca
caagctttagatgtgggttggcttgtctttgatatcaccgtgaccagcaatcattgggtg
attaatccacagaacaatttgggcttacagctctgcgcagagacgggggatggacgcagc
atcaatgtaaaatctgccggtctcgtgggaagacacgggcctcagtcaaagcagccgttc
atggtggccttcttcaaggcaagtgaggttcttcttcgatctgtgagagcagccagcaaa
cggaaaaaccaaaaccgcaataaatccagctctcatcaggacccctccaggattcccagt
gctggagattataataccagtgaacagaaacaagcttgcaagaagcacgagctctatgtg
agtttccgcgatctgggatggcaggactggatcatagcaccagaaggatatgccgcattt
tattgcgatggagaatgttcttttccacttaacgcccacatgaatgccactaaccatgcc
atagtccagactctggtacacctgatgtttcctgaccatgttcccaagccctgttgtgct
ccaaccaaactaaatgccatctcggtcctgtactttgatgacagctccaatgtaattttg
aaaaagtacagaaatatggtagtccgttcatgtggctgccactag

KEGG   Rattus norvegicus (rat): 679119
Entry
679119            CDS       T01003                                 

Gene name
Bmp8b
Definition
(RefSeq) bone morphogenetic protein 8B isoform X1
  KO
K16622  bone morphogenetic protein 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
rno04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    679119 (Bmp8b)
   04390 Hippo signaling pathway
    679119 (Bmp8b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    679119 (Bmp8b)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    679119 (Bmp8b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    679119 (Bmp8b)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   679119 (Bmp8b)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 679119
NCBI-ProteinID: XP_002729572
RGD: 1591873
Ensembl: ENSRNOG00000033209
UniProt: D3ZWC5
Position
5
AA seq 399 aa
MAAGPGLLWLLGLALCVLGSSHLPRSPHVFPQHRLGVREPRDMQREIREVLGLPGRPRSR
APLATAQQPASAPLFMLNLYHAMTDDSGNGPPQPHLHRADLIMSFVNIVEHDRTLGYQEP
HWKEFHFDLTQIPAGEAVTAAEFRIYKEPSTHPPNTTLHISMFEVVQERSNRESDLFFLD
LQTLRSGDEGWLVLDITAASDRWLLNHNKDLGLRLYVETEDGHSLDPGLAGLLGQTAPRS
RQPFMVGFFKASQSPVRAPRTARPLKKKKLNQVNQLPNSNKHLGIFDDGHGSLDREVCRR
HELYVSFRDLGWLDSVIAPQGYSAYYCAGECIYPLNSCMNSTNHATMQALVHLMKPDIVP
KVCCVPTKLSAISLLYYDRNNNVILRRERNMVVQACGCH
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggctgcgggtcccgggctcctctggctgctgggcctggctctgtgcgtgctgggcagc
agccacctcccgcgttccccgcacgtctttccccagcatcgactgggagtgcgcgagccc
cgcgacatgcagcgcgagatccgggaggtgctggggttgccggggcggccccgatctcga
gcaccactagcgactgcccagcagccagcgtctgcgcccctctttatgttgaacctgtat
catgccatgacggatgacagtggcaacgggcccccgcagcctcatctgcaccgcgctgac
ctgattatgagctttgtcaacatagtggagcacgaccgtaccctgggctaccaggagcca
cactggaaggaattccactttgacttaacccagatccctgctggtgaggctgtcacagcc
gctgagttccggatatacaaagagcccagcacccacccgcccaacacaaccctccacatc
agcatgtttgaagtggtccaggagcgctccaacagggagtctgacttgttctttttggat
cttcagacgctccggtctggggacgagggctggctggtgctggacatcacagcagccagt
gaccgatggctgctgaaccataacaaggacctgggactccgcctctatgtggaaaccgag
gatgggcacagcttggatcctggcctggctggtctgcttggacaaacagcaccacgctcc
agacagcctttcatggttggtttcttcaaggctagccagagtcctgtgcgggcccctcga
acagcaagaccactgaagaagaagaagttaaatcaagtcaaccaactgccgaactccaac
aaacacctaggaatctttgatgatggccacggttccctcgacagagaggtttgccgcaga
cacgagctgtatgtcagcttccgtgacctcggctggctggactctgtcattgccccccag
ggctactcagcctattactgtgccggggagtgcatctacccactgaactcctgcatgaac
tccaccaaccacgccactatgcaggccctggtacatctgatgaagccagatatcgtcccc
aaggtgtgctgtgtgcccaccaagctgagtgccatttctctgctctactatgatagaaac
aataatgtcatccttcgcagggagcgcaacatggtggtccaggcctgtggctgccactga

KEGG   Rattus norvegicus (rat): 680931
Entry
680931            CDS       T01003                                 

Gene name
Bmp8a
Definition
(RefSeq) bone morphogenetic protein 8A precursor
  KO
K16622  bone morphogenetic protein 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
rno04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    680931 (Bmp8a)
   04390 Hippo signaling pathway
    680931 (Bmp8a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    680931 (Bmp8a)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    680931 (Bmp8a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    680931 (Bmp8a)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   680931 (Bmp8a)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 680931
NCBI-ProteinID: NP_001102902
RGD: 1585858
Ensembl: ENSRNOG00000030155
UniProt: D3ZTI5
Position
5
AA seq 399 aa
MAVRPGPLWLLGLALCALGGGHGPRPPHTCPQRRLGARERRDMQREILAVLGLPGRPRPR
APPAAARQPASAPLFMLDLYHAMTDDDDGGPPQAHLGRADLVMSFVNMVERDRTLGYQEP
HWKEFHFDLTQIPAGEAVTAAEFRIYKEPSTHPPNTTLHISMFEVVQERSNRESDLFFLD
LQTLRSGDEGWLVLDITAASDRWLLNHNKDLGLRLYVETEDGHSLDPGLAGLLGQTAPRS
RQPFMVTFFRASSSPVRTPRAVRPLKRRQPKKTNELPHPNKLPGIFDDGHGSRGREVCRR
HELYVSFRDLGWLDWVIAPQGYSAYYCEGECAFPLDSCMNATNHAILQSLVHLMKPDVVP
KACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggccgtacgtcccgggccactctggctattgggcctggctctgtgcgcgctgggagga
ggccacggtccgcgtcccccgcacacctgtccccagcgtcgcctgggagcgcgcgagcgc
cgcgacatgcagcgcgaaatcctggcagtgctcgggctacccgggagaccccgaccccgt
gcgccacccgccgctgctcggcagccagcatccgcgcccctcttcatgttggacctgtat
cacgccatgaccgatgacgacgacggcgggccaccgcaggctcacttgggccgtgccgac
ctggtcatgagcttcgtcaacatggtggagcgcgaccgtaccctgggctaccaggagccg
cactggaaggaattccactttgacttaacccagatccctgctggtgaggctgtcacagcc
gctgagttccggatatacaaagagcccagcacccacccgcccaacacaaccctccacatc
agcatgtttgaagtggtccaggagcgctccaacagggagtctgacttgttctttttggat
cttcagacgctccggtctggggacgagggctggctggtgctggacatcacagcagccagt
gaccgatggctgctgaaccataacaaggacctgggactccgcctctatgtggaaaccgag
gatgggcacagcctggatcctggcctggctggtctgcttggacaaacagcaccacgctcc
agacagcctttcatggtcaccttcttcagagccagctcgagtcctgtgcggacccctcgg
gcagtgagaccgctgaagaggaggcagccaaagaaaacaaacgagcttccacatcccaac
aaactcccagggatctttgatgatggccacggttcccgaggcagagaggtttgccgcaga
cacgagctgtacgtcagcttccgtgacctcggctggctggactgggtcatcgccccccag
ggctactccgcctattactgtgagggagagtgtgctttcccactggactcctgtatgaat
gccaccaaccatgccatcttgcagtctctggtgcacctgatgaaaccagatgtcgtcccc
aaggcatgctgtgctcccaccaaactgagtgccacctctgtgctctactatgacagcagc
aacaatgtcatcctgcggaagcaccgcaacatggtggtcaaggcctgcggctgccactga

KEGG   Rattus norvegicus (rat): 85272
Entry
85272             CDS       T01003                                 

Gene name
Bmp7
Definition
(RefSeq) bone morphogenetic protein 7 precursor
  KO
K16621  bone morphogenetic protein 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04360  Axon guidance
rno04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    85272 (Bmp7)
   04390 Hippo signaling pathway
    85272 (Bmp7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    85272 (Bmp7)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    85272 (Bmp7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    85272 (Bmp7)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    85272 (Bmp7)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   85272 (Bmp7)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   85272 (Bmp7)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 85272
NCBI-ProteinID: NP_001178785
RGD: 620743
Ensembl: ENSRNOG00000053384
UniProt: G3V6W8
Position
3
AA seq 430 aa
MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILS
ILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEESGPDGQGFSYPYKAVFSTQGPPLASL
QDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYI
RERFDNETFQITVYQVLQEHSGRESDLFLLDSRTIWASEEGWLVFDITATSNHWVVNPRH
NLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHLRSIRSTGGKQRSQ
NRSKTPKNQEALRMASVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEG
ECAFPLNSYMNATNHAIVQTLVHFINPDTVPKPCCAPTQLNAISVLYFDDSSNVILKKYR
NMVVRACGCH
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgcacgtgcgctcgctgcgcgctgcggcgccacacagcttcgtggcgctctgggcgcct
ctgttcttgctgcgctctgccttggccgacttcagcctggacaacgaggtgcactccagt
ttcatccaccggcgcctccgcagtcaggagcggcgggagatgcagcgggaaatcctgtcc
atcttgggcttgccccatcgtccgcgcccgcacctccagggaaaacataattcggcgccc
atgttcatgttggacctgtacaacgccatggcggtggaggagagtgggccggacggacag
ggcttctcctacccctacaaggccgtcttcagtacccagggtccccctttggccagcctg
caggacagccacttcctcaccgacgccgacatggtcatgagcttcgtcaacctagtggag
cacgacaaggaattcttccaccctcgataccaccatcgagagttccggtttgatctttcc
aagatccccgagggagaggcggtgaccgcagccgagttcaggatctataaggactacatc
cgggagcggtttgacaacgagaccttccagatcacagtctatcaggtgctccaggagcac
tcaggcagggagtccgacctcttcttgctggacagccgtaccatctgggcttctgaggag
ggctggttggtatttgacatcacagccaccagcaaccactgggtggtcaaccctcggcac
aacctgggcttacagctctccgtggagaccctggatgggcagagcatcaaccccaagttg
gcaggcctgattggacggcatggaccccagaacaagcaacccttcatggtggccttcttc
aaggccacggaggttcatctccgtagcatccggtccacggggggcaaacaacgcagccag
aaccgctccaagactccaaagaaccaagaggcactgaggatggccagtgtggcagaaaac
agcagcagtgaccagaggcaggcctgcaagaaacacgagctgtatgttagcttccgagac
cttggctggcaggactggatcatcgcacctgaaggctatgctgcctactactgtgaggga
gagtgtgccttccctctgaactcctacatgaacgccaccaaccatgctatcgtccagaca
ctggttcacttcatcaacccagacaccgtacccaagccctgctgtgcccccacccagctc
aacgcgatatctgtcctctacttcgacgacagctccaacgtcatcctgaagaagtacaga
aacatggtggtccgggcctgtggctgccactag

DBGET integrated database retrieval system