KEGG   Rattus norvegicus (rat): 252834
Entry
252834            CDS       T01003                                 

Gene name
Gdf6, BMP-13, gdf16
Definition
(RefSeq) growth differentiation factor 6
  KO
K20012  growth differentiation factor 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    252834 (Gdf6)
   04390 Hippo signaling pathway
    252834 (Gdf6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    252834 (Gdf6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    252834 (Gdf6)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   252834 (Gdf6)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 252834
NCBI-ProteinID: NP_001013056
RGD: 620104
Ensembl: ENSRNOG00000007810
Vega: OTTRNOG00000000815
UniProt: Q6HA10
Position
5q13
AA seq 452 aa
MDTPRVLLWAIFLISFLWDLPGFQQASISSSSSTELDSTKDVENRKGGKMQRTPQESAEG
RTPKEHRPRPNELRRRLPGQSLGQEPPGRGPRVVPHEYMLSIYRTYSIAEKLGINASFFQ
SSKSANTITSFVDRGLDDLSHTPLRRQKYLFDVSTLSDKEELVGAELRLYRQAPPTPWGP
QTRPLHLQLFPCLSPLLLDSRTLDPQGPTEAGWEVFDVWQVLRPQPWKQLCLELRAVWGE
LDARDSGARPRGPQQSPPLDLRSLGFGRRVRPPQERALLVVFTRSQRKNLFTEMHEQLGS
AEAAGAEGSWPAPSGAPDAGSWLPSPGRRRRRTALSSRHGKRHGKKSRLRCSRKPLHVNF
KELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPT
KLTPISILYIDAGNNVVYKQYEDMVVESCGCR
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggacactcctagggtccttctctgggcgatcttcctcatcagcttcctctgggatttg
ccgggtttccagcaggcttccatctcctcgtcctcctccaccgaattggactccaccaag
gacgtggagaaccgcaagggagggaagatgcagcggactccccaagagagtgccgagggc
cggacgcccaaggagcaccggccgcggccgaatgagctcaggcggcgactgccgggacaa
tctctggggcaggagccgccgggcagggggccgcgcgtggtgcctcacgagtacatgctg
tcaatctacaggacttactccattgccgagaagctgggcatcaatgccagctttttccag
tcttccaagtcagctaatacgatcactagctttgtagacagaggactggacgatctctcg
cacactcctctccggagacagaagtatttgtttgatgtgtccacgctctcagacaaagaa
gagctggtgggcgcagagctgaggctttatcgccaggcgcccccaacgccctgggggcca
caaacccgaccgctgcatttgcagctcttcccctgtttgtccccattgttactggactct
aggaccctggatcctcaggggccaacagaagctggctgggaagttttcgacgtgtggcag
gtcctgcgccctcagccgtggaagcagctgtgcttggagcttcgggcagtctggggtgag
ctggacgccagggattcaggagcgcgcccgaggggtccccaacagtcaccgcccctggac
ctgcggagtctgggcttcggccggagggtgcggccgccccaggagcgcgccctgcttgtc
gtgttcaccagatcgcagcgcaagaacctgttcactgagatgcatgagcagctgggctct
gcagaggctgccggagccgaggggtcatggccagcgccgtcgggcgccccagacgccggg
tcttggctgccctcgcccggccgccggcggcgacgcaccgccctcagcagccgtcacggc
aagcgacacggcaagaagtccaggctgcgctgcagcagaaaacctctgcacgtgaatttt
aaggagttaggctgggacgattggattatcgcgcccctagagtacgaggcctatcactgc
gagggcgtgtgcgactttccgctgcgctcgcacctggagcccaccaaccatgccatcatc
caaacgctgatgaactccatggacccgggctccaccccacccagctgctgtgttcccacc
aaattgactcccatcagcatcctgtacatcgatgcgggcaataatgtggtctacaagcag
tacgaggacatggtggtggagtcctgtggttgtaggtag

DBGET integrated database retrieval system