KEGG   Rattus norvegicus (rat): 25284
Entry
25284             CDS       T01003                                 

Gene name
Amacr, Da1-8, Marc1
Definition
(RefSeq) alpha-methylacyl-CoA racemase
  KO
K01796  alpha-methylacyl-CoA racemase [EC:5.1.99.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00120  Primary bile acid biosynthesis
rno01100  Metabolic pathways
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    25284 (Amacr)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    25284 (Amacr)
Enzymes [BR:rno01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.4  alpha-methylacyl-CoA racemase
     25284 (Amacr)
SSDB
Motif
Pfam: CoA_transf_3
Other DBs
NCBI-GeneID: 25284
NCBI-ProteinID: NP_036948
RGD: 3048
Ensembl: ENSRNOG00000018662
UniProt: G3V8F9 Q5BK88
Position
2q16
AA seq 382 aa
MALRGVRVLELAGLAPGPFCGMILADFGAEVVLVDRLGSVNHPSHLARGKRSLALDLKRS
PGAAVLRRMCARADVLLEPFRCGVMEKLQLGPETLQQDNPKLIYARLSGFGQSGIFSKVA
GHDINYVALSGVLSKIGRSGENPYPPLNLLADFGGGGLMCTLGILLALFERTRSGLGQVI
DANMVEGTAYLSTFLWKTQAMGLWAQPRGQNLLDGGAPFYTTYKTADGEFMAVGAIEPQF
YTLLLKGLGLESEELPSQMSIEDWPEVKKKFADVFARKTKAEWCQIFDGTDACVTPVLTL
EEALHHQHNRERGSFITDEEQHASPRPAPQLSRTPAVPSAKRDPSVGEHTVEVLKDYGFS
QEEIHQLHSDRIIESNKLKANL
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggcgctgcgtggcgtcagggttctggagctggcaggcctggccccagggccgttctgc
gggatgatcctggcggacttcggcgccgaggtggtgctcgtggacagactgggctccgtg
aaccaccccagtcacctggcccgaggcaagcgctcgctggcgctggacctgaagcggtct
ccgggagccgcggtgttgcggcgcatgtgcgcacgcgcggacgtgttgctggagcccttc
cgttgcggtgtcatggagaaactccagcttgggccagagactctacagcaggacaatcca
aagctcatctatgccaggctgagtggatttggccagtcgggaattttctccaaagtagct
ggccatgacatcaactatgtggctttgtcaggtgtcctgtcaaagattggcaggagcggt
gagaacccataccctcccctgaacctcctggccgactttggtggcggtggcctcatgtgc
acattgggcattttgctggctctcttcgaacgcacgcggtctggcctagggcaggtcatt
gatgcgaacatggtggaaggaacggcatacttaagtactttcctgtggaaaactcaagcc
atgggtctgtgggcacagcctcgagggcaaaacctgttagatggcggggcacctttctac
acaacctacaagaccgcagatggggagttcatggctgtaggtgcaatagaaccccagttc
tacacactgctgcttaaaggacttggacttgagtctgaggaactccccagccagatgagc
atagaagattggccagaagtgaagaagaaatttgcagatgtgtttgcaaggaagactaag
gcagagtggtgccagatctttgacgggacagatgcatgtgtgaccccagtgctgactctt
gaggaggccctccaccaccagcacaacagagaacggggctccttcatcactgacgaggag
cagcatgcaagcccccgtcctgcaccccagctttccagaacccctgctgttccttctgcc
aaaagggacccttctgtgggagagcacactgtagaggtgcttaaagactatggattcagt
caggaagagatccatcagctgcactcggatagaatcattgaaagtaataagctaaaagcc
aacctctga

DBGET integrated database retrieval system