KEGG   Rattus norvegicus (rat): 252859Help
Entry
252859            CDS       T01003                                 

Gene name
Mlnr, Trhr2
Definition
(RefSeq) motilin receptor
  KO
K04282  thyrotropin-releasing hormone receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    252859 (Mlnr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    252859 (Mlnr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    252859 (Mlnr)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Thyrotropin-releasing hormone (TRH)
    252859 (Mlnr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srw 7TM_GPCR_Srv TAS2R
Motif
Other DBs
NCBI-GeneID: 252859
NCBI-ProteinID: NP_852029
RGD: 621262
Ensembl: ENSRNOG00000012789
UniProt: Q9R297
Position
19q12
AA seq 352 aa AA seqDB search
MDGPSNVSLIHGDTTLGLPEYKVVSVFLVLLVCTLGIVGNAMVILVVLTSRDMHTPTNCY
LVSLALADLLVLLAAGLPNVSDSLVGHWIYGRAGCLGITYFQYLGINVSSFSILAFTVER
YIAICHPLRAQTVCTVARAKRIIAGIWGVTSLYCLLWFFLVDLNVRDNQRLECGYKVPRG
LYLPIYLLDFAVFFIGPLLVTLVLYGLIGRILFQSPLSQEAWQKERQPHGQSEAAPGNCS
RAKSSRKQATRMLAVVVLLFAVLWTPYRTLVLLNSFVAQPFLDPWVLLFCRTCVYTNSAV
NPVVYSLMSQKFRAAFLKLCWCRAAGPQRRAARVLTSNYSAAQETSEGTEKM
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggatggccccagtaatgtctcgctcattcacggtgacaccacgctgggcctgccagag
tacaaggtggtctcagtcttcctagtgctcctggtgtgcaccctgggcatcgtgggcaat
gccatggtgattctggtggtgctgacctcacgtgacatgcacacacccaccaactgctac
ctggtcagcctggccctcgctgacctcctcgtgctgctggctgcgggtctgcccaatgtc
tctgacagcctagtggggcactggatctatggacgtgctggctgcttgggcatcacctac
ttccagtacctgggcatcaatgtctcctccttctccatcctggccttcactgtggagagg
tatatagccatttgccacccactgagagcacagaccgtgtgcactgtggcccgggccaaa
cggatcatcgcaggcatctggggggtcacgtccctctattgcctactctggttcttcctg
gtggatctcaatgtccgtgacaaccagcgccttgaatgtggctacaaagtgccccgagga
ctctacctgcccatctacctgctggacttcgctgtctttttcatcggacccttgctggtg
accctcgtgctctatgggctcatcgggaggattttatttcagagcccgttgtcccaggaa
gcctggcagaaggagaggcagccccatgggcagagcgaggctgcaccaggcaactgctcc
agggccaagagctccaggaagcaggccaccaggatgctggccgtggttgtgttgcttttt
gccgtgctgtggaccccttaccgcacactggtactgctcaactcctttgtggcccagcct
ttcctggacccctgggtcctgctgttctgccgcacctgtgtctacaccaacagcgctgtc
aaccctgtcgtctacagcctgatgtcacagaagttccgggcggccttcctgaaactgtgc
tggtgcagggcagctgggccacagcggagggcagcacgcgtcctcaccagtaactacagt
gccgcccaggagacctcagaaggaactgagaagatgtag

DBGET integrated database retrieval system