KEGG   Rattus norvegicus (rat): 252887Help
Entry
252887            CDS       T01003                                 

Gene name
Olr1413, Olfr30, TPCR05
Definition
(RefSeq) olfactory receptor 1413
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    252887 (Olr1413)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    252887 (Olr1413)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    252887 (Olr1413)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 252887
NCBI-ProteinID: NP_999986
RGD: 621541
Ensembl: ENSRNOG00000026801
UniProt: G3V922
Position
10q22
AA seq 315 aa AA seqDB search
MSTEPWNHSITGFVLTSLFDNSQTHLFLFSMVVLVYILAMVGNTAMVLLIWMDPRLHTPM
YFLLSQLSFLDIFFTSVTVPKMMVGFLFGWTSISFGGCGAQMFFFMFLGAAECLLLALMA
YDRYVAICNPLRYPVLMSGRVCLLMVVASWLGGSLNASIQTSLTLQFPYCGSRKISHFFC
EVPSLLMLACADTEAYEQVLFVTGVVVLLVPITFITASYALILAAVLRMHSAEGRQKALA
TCSSHLTVVNLFYGPLVYTYMLPASYHSPGQDDVVSVFYTVLTPMLNPVIYSLRNKEVTG
AMKKAVGRCRVSRNA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgagccctggaaccactccatcactggctttgtgctgacgagcctttttgac
aacagccagacacacctgttcctgtttagcatggtggtgttggtctacatccttgctatg
gtgggcaacacagccatggtccttttgatttggatggacccccgactccacacccccatg
tacttcctcctcagccagttgtcctttctggacatcttctttacctcagtcactgtcccc
aagatgatggtaggctttctctttggttggacaagcatctctttcggaggctgtggggca
cagatgtttttcttcatgttcctgggggctgcagagtgcctcctgctggccctcatggct
tacgatcgttatgtggctatctgcaaccctctgcgctacccagtgctcatgagcggccgg
gtgtgcctgctcatggtcgtggcctcctggttgggaggatccctcaacgcctccattcag
acttctctgacccttcagttcccctactgtggatcacggaagatctcccacttcttctgt
gaggtgccctcgctgctgatgctggcctgtgcagacactgaagcctatgagcaggtacta
tttgtgacaggcgtggtggtcctcctggtgcccattacattcattactgcctcttatgcc
ctcatcctggctgctgtgctccgaatgcactctgcggaggggcgtcagaaggccctagcc
acatgctcctctcacctgacagtcgtcaatctcttctatgggccccttgtctacacctac
atgttacctgcttcctatcactcaccaggccaagacgacgtagtatccgtcttttacacc
gttctcacacccatgcttaaccctgtcatctacagcctcaggaacaaggaagttacaggg
gcaatgaagaaagcagtggggaggtgtagagtcagtaggaatgcctga

DBGET integrated database retrieval system