KEGG   Rattus norvegicus (rat): 25289Help
Entry
25289             CDS       T01003                                 

Gene name
Adcy6, AC6, ACVI, ADCYB
Definition
(RefSeq) adenylate cyclase 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01522  Endocrine resistance
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04114  Oocyte meiosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04727  GABAergic synapse
rno04742  Taste transduction
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04921  Oxytocin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing's syndrome
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04962  Vasopressin-regulated water reabsorption
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04976  Bile secretion
rno05032  Morphine addiction
rno05166  HTLV-I infection
rno05200  Pathways in cancer
rno05414  Dilated cardiomyopathy (DCM)
Module
rno_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    25289 (Adcy6)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    25289 (Adcy6)
   04371 Apelin signaling pathway
    25289 (Adcy6)
   04072 Phospholipase D signaling pathway
    25289 (Adcy6)
   04024 cAMP signaling pathway
    25289 (Adcy6)
   04022 cGMP - PKG signaling pathway
    25289 (Adcy6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    25289 (Adcy6)
  Cellular community - eukaryotes
   04540 Gap junction
    25289 (Adcy6)
 Organismal Systems
  Immune system
   04611 Platelet activation
    25289 (Adcy6)
   04062 Chemokine signaling pathway
    25289 (Adcy6)
  Endocrine system
   04911 Insulin secretion
    25289 (Adcy6)
   04923 Regulation of lipolysis in adipocyte
    25289 (Adcy6)
   04912 GnRH signaling pathway
    25289 (Adcy6)
   04913 Ovarian Steroidogenesis
    25289 (Adcy6)
   04915 Estrogen signaling pathway
    25289 (Adcy6)
   04914 Progesterone-mediated oocyte maturation
    25289 (Adcy6)
   04921 Oxytocin signaling pathway
    25289 (Adcy6)
   04926 Relaxin signaling pathway
    25289 (Adcy6)
   04918 Thyroid hormone synthesis
    25289 (Adcy6)
   04928 Parathyroid hormone synthesis, secretion and action
    25289 (Adcy6)
   04916 Melanogenesis
    25289 (Adcy6)
   04924 Renin secretion
    25289 (Adcy6)
   04925 Aldosterone synthesis and secretion
    25289 (Adcy6)
   04927 Cortisol synthesis and secretion
    25289 (Adcy6)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    25289 (Adcy6)
   04270 Vascular smooth muscle contraction
    25289 (Adcy6)
  Digestive system
   04970 Salivary secretion
    25289 (Adcy6)
   04971 Gastric acid secretion
    25289 (Adcy6)
   04972 Pancreatic secretion
    25289 (Adcy6)
   04976 Bile secretion
    25289 (Adcy6)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    25289 (Adcy6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    25289 (Adcy6)
  Nervous system
   04724 Glutamatergic synapse
    25289 (Adcy6)
   04727 GABAergic synapse
    25289 (Adcy6)
   04725 Cholinergic synapse
    25289 (Adcy6)
   04723 Retrograde endocannabinoid signaling
    25289 (Adcy6)
  Sensory system
   04742 Taste transduction
    25289 (Adcy6)
   04750 Inflammatory mediator regulation of TRP channels
    25289 (Adcy6)
  Aging
   04211 Longevity regulating pathway - mammal
    25289 (Adcy6)
   04213 Longevity regulating pathway - multiple species
    25289 (Adcy6)
  Environmental adaptation
   04713 Circadian entrainment
    25289 (Adcy6)
   04714 Thermogenesis
    25289 (Adcy6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    25289 (Adcy6)
  Substance dependence
   05032 Morphine addiction
    25289 (Adcy6)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    25289 (Adcy6)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    25289 (Adcy6)
  Infectious diseases
   05166 HTLV-I infection
    25289 (Adcy6)
  Drug resistance
   01522 Endocrine resistance
    25289 (Adcy6)
Enzymes [BR:rno01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     25289 (Adcy6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA DUF5134
Motif
Other DBs
NCBI-GeneID: 25289
NCBI-ProteinID: NP_036953
RGD: 2035
Ensembl: ENSRNOG00000054757
UniProt: Q03343
Position
7q36
AA seq 1166 aa AA seqDB search
MSWFSGLLVPKVDERKTAWGERNGQKRPRQATRARGFCAPRYMSCLKNVEPPSPTPAART
RCPWQDEAFIRRAGPGRGVKLGLRSVALGFDDTEVTTPMGTAEVAPDTSPRSGPSCWHRL
AQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLMAVLLTFHAAPALPQPAYVA
LLTCASVLFVVLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAANPRSPSAGLWCP
VFFVYITYTLLPIRMRAAVLSGLGLSTLHLILAWHLNNGDPFLWKQLGANVVLFLCTNAI
GVCTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKK
EDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLR
IKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHC
GVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNGYL
KEQCIETFLILGASQKRKEEKAMLVKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFRQM
GIDDSSKENRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYS
RKVDPRFGAYVACALLVFCFICFIQFLVFPHSALILGIYAGIFLLLLVTVLICAVCSCGS
FFPNALQRLSRSIVRSRVHSTAVGVFSVLLVFISAIANMFTCSHTPLRTCAARMLNLTPS
DVTACHLRQINYSLGLEAPLCEGTAPTCSFPEYFVGSVLLSLLASSVFLHISSIGKLVMT
FVLGFIYLLLLLLGPPATIFDNYDLLLSVHGLASSNETFDGLDCPAVGRVALKYMTPVIL
LVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLA
RERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEE
RFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQ
MKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQ
LECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
atgtcatggtttagcggcctcctggttcccaaagtggatgaacggaaaacagcctggggc
gaacgcaatggacagaagcgcccacgccaggcgacccgagcccgtggcttctgcgcgccc
cgctacatgagctgcctcaagaatgtggagccacccagccccactcctgcagctcgcact
cggtgcccctggcaggatgaagccttcatcaggagggctggcccgggaaggggtgtgaag
ctggggctgcggtcagtggccttgggttttgatgacactgaggtgaccacaccgatgggg
acagctgaagtggcacccgacacatcgcctcgaagcggtccgtcctgctggcaccggcta
gcgcaggtgttccagtctaagcagttccgctccgccaagctggagcgtctgtaccagcgg
tacttcttccagatgaaccagagcagcctcacgctgctcatggcggtgcttgtgctcctc
atggctgtactgttgaccttccacgccgcgcctgccctgcctcagcctgcttatgtggcc
ctgctgacctgtgcctccgtcctttttgtggtactcatggtagtgtgtaaccgacatagc
ttccgccaggactccatgtgggtagtgagctatgtggttctgggcatcctagcagccgtg
caagtcgggggtgccctggcagccaacccacgcagcccctcagcaggcctttggtgcccc
gtgttcttcgtctacatcacctacacacttcttcccattcgtatgcgagcggccgtgctc
agtggcctgggtctttccaccctgcatttgattttggcctggcatctcaacaatggtgac
cccttcctttggaagcagctcggtgctaacgtggtgctcttcctgtgcaccaatgccatc
ggtgtctgcacgcactaccccgctgaagtgtctcagcgccaagcctttcaggagacccgt
ggttacatccaggcccggctgcacttgcagcatgagaatcgacagcaggaacggctgctg
ctgtcggtgttgccccagcatgttgccatggaaatgaaagaggatatcaacacaaaaaag
gaagacatgatgttccacaagatttacatccagaagcatgacaatgtcagcatcctgttt
gccgacatcgagggcttcaccagcctggcctcccagtgcactgcccaggaactggtcatg
accttgaatgagctctttgcccggttcgacaagctggctgcggagaatcactgtctgagg
atcaagatcttaggagactgttactactgtgtgtcggggctgccggaggcccgggcagac
catgcccactgctgtgtggagatgggggtagacatgatcgaggccatctcgctggtgcgt
gaggtaacgggtgtaaatgtgaacatgcgcgtgggcatccacagcgggcgtgtacactgc
ggtgtccttggtctgcggaaatggcagtttgatgtctggtccaacgatgtgaccctggcc
aaccacatggaggcggggggccgggccggccgcatccacatcactcgggccacactgcag
tacctgaacggggactatgaggtggagccaggccgtggcggtgagcgcaacggctacctc
aaggagcagtgcattgagaccttcctcatactaggagccagccagaaacggaaagaggag
aaggccatgctggtcaagctgcagcggacgcgggccaactccatggaaggactgatgccc
cgctgggttcctgaccgtgccttctcccggaccaaggactctaaggcattccgacagatg
ggcatcgatgactctagcaaagagaaccggggtgcccaagatgctctgaaccctgaggat
gaggtggacgagtttctgggccgagccatcgatgcccgaagcatcgaccagctgcgtaag
gaccatgtgcgccggttcctgctcaccttccagagggaggatctcgagaagaagtattca
cggaaagtagaccctcgtttcggagcctacgtcgcctgtgccctcctggttttctgcttc
atctgtttcatccagttcctcgtattcccacactccgccctgatactcgggatttatgcc
gggatcttccttttgctgctggtcaccgtgctcatctgtgctgtgtgctcctgtgggtct
ttcttccccaacgccctgcagcgcctgtcccgcagtatcgtccgctcacgggtgcacagc
acggctgttggagtcttctcggttctgcttgtgttcatctctgccattgccaacatgttc
acctgcagtcacaccccactgaggacctgtgcggcccggatgctgaacttaacaccgtcc
gatgtcaccgcctgtcacctacgacagatcaattactctctgggactggaagctcccctg
tgtgagggcacagcacccacctgcagtttccctgagtactttgtcgggagtgtgctgttg
agtctcttggccagctccgtcttcctccacatcagcagcattggcaagctagttatgacc
tttgtcttggggttcatctacttgcttctgcttttgctgggtcccccagccaccatcttt
gacaactatgatctactgcttagcgtccatggcttggcttcctccaatgagaccttcgat
gggctggactgcccagccgtagggagggtagcgctcaaatacatgacccctgtgattctc
ctcgtgttcgccctggcactgtatctacacgcacaacaggtggaatctaccgcccgcctg
gacttcctgtggaaactgcaggccacaggggagaaggaggagatggaggagttgcaggcc
tacaaccggcggctgctgcataacatccttcccaaggacgtggctgcccacttcctggcc
cgggagcgccgcaacgacgagctgtactaccaatcctgcgagtgcgtggctgtcatgttt
gcctccatcgccaacttctctgagttctatgtggaactggaggcgaacaatgagggcgtg
gagtgcctgcgactgctcaatgagatcatcgcggactttgatgagatcatcagtgaggag
aggttccggcagctggagaagatcaagaccatcggtagcacttacatggccgcctccggg
ctaaatgccagcacctatgaccaggtcggccgctcgcacatcaccgccctggcagactac
gccatgcggcttatggagcaaatgaaacacatcaacgaacactctttcaacaacttccag
atgaagatcgggttgaacatgggtccggttgtagcaggtgtcattggggcccggaagcca
cagtatgacatctggggaaacacggtgaatgtttccagccgtatggacagcacaggagtt
cctgaccgaatacaggtgaccacggatctctaccaggttctagctgccaagggctaccaa
ctggagtgtcgaggggtggtcaaggtgaagggaaagggggagatgaccacctacttcctc
aatgggggccccagcagttag

DBGET integrated database retrieval system