KEGG   Rattus norvegicus (rat): 25289
Entry
25289             CDS       T01003                                 

Gene name
Adcy6
Definition
(RefSeq) adenylate cyclase type 6 isoform 2
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno01522  Endocrine resistance
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04114  Oocyte meiosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04727  GABAergic synapse
rno04742  Taste transduction
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04921  Oxytocin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04962  Vasopressin-regulated water reabsorption
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04976  Bile secretion
rno05032  Morphine addiction
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    25289 (Adcy6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    25289 (Adcy6)
   04371 Apelin signaling pathway
    25289 (Adcy6)
   04072 Phospholipase D signaling pathway
    25289 (Adcy6)
   04024 cAMP signaling pathway
    25289 (Adcy6)
   04022 cGMP-PKG signaling pathway
    25289 (Adcy6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    25289 (Adcy6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    25289 (Adcy6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    25289 (Adcy6)
   04062 Chemokine signaling pathway
    25289 (Adcy6)
  09152 Endocrine system
   04911 Insulin secretion
    25289 (Adcy6)
   04923 Regulation of lipolysis in adipocytes
    25289 (Adcy6)
   04912 GnRH signaling pathway
    25289 (Adcy6)
   04913 Ovarian steroidogenesis
    25289 (Adcy6)
   04915 Estrogen signaling pathway
    25289 (Adcy6)
   04914 Progesterone-mediated oocyte maturation
    25289 (Adcy6)
   04921 Oxytocin signaling pathway
    25289 (Adcy6)
   04926 Relaxin signaling pathway
    25289 (Adcy6)
   04935 Growth hormone synthesis, secretion and action
    25289 (Adcy6)
   04918 Thyroid hormone synthesis
    25289 (Adcy6)
   04928 Parathyroid hormone synthesis, secretion and action
    25289 (Adcy6)
   04916 Melanogenesis
    25289 (Adcy6)
   04924 Renin secretion
    25289 (Adcy6)
   04925 Aldosterone synthesis and secretion
    25289 (Adcy6)
   04927 Cortisol synthesis and secretion
    25289 (Adcy6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    25289 (Adcy6)
   04270 Vascular smooth muscle contraction
    25289 (Adcy6)
  09154 Digestive system
   04970 Salivary secretion
    25289 (Adcy6)
   04971 Gastric acid secretion
    25289 (Adcy6)
   04972 Pancreatic secretion
    25289 (Adcy6)
   04976 Bile secretion
    25289 (Adcy6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    25289 (Adcy6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    25289 (Adcy6)
  09156 Nervous system
   04724 Glutamatergic synapse
    25289 (Adcy6)
   04727 GABAergic synapse
    25289 (Adcy6)
   04725 Cholinergic synapse
    25289 (Adcy6)
   04723 Retrograde endocannabinoid signaling
    25289 (Adcy6)
  09157 Sensory system
   04742 Taste transduction
    25289 (Adcy6)
   04750 Inflammatory mediator regulation of TRP channels
    25289 (Adcy6)
  09149 Aging
   04211 Longevity regulating pathway
    25289 (Adcy6)
   04213 Longevity regulating pathway - multiple species
    25289 (Adcy6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    25289 (Adcy6)
   04714 Thermogenesis
    25289 (Adcy6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25289 (Adcy6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25289 (Adcy6)
   05163 Human cytomegalovirus infection
    25289 (Adcy6)
  09165 Substance dependence
   05032 Morphine addiction
    25289 (Adcy6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    25289 (Adcy6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    25289 (Adcy6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    25289 (Adcy6)
Enzymes [BR:rno01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     25289 (Adcy6)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD GBR2_CC
Other DBs
NCBI-GeneID: 25289
NCBI-ProteinID: NP_036953
RGD: 2035
Ensembl: ENSRNOG00000054757
UniProt: Q03343
Position
7
AA seq 1166 aa
MSWFSGLLVPKVDERKTAWGERNGQKRPRQATRARGFCAPRYMSCLKNVEPPSPTPAART
RCPWQDEAFIRRAGPGRGVELGLRSVALGFDDTEVTTPMGTAEVAPDTSPRSGPSCWHRL
AQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLMAVLLTFHAAPALPQPAYVA
LLTCASVLFVVLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAANPRSPSAGLWCP
VFFVYITYTLLPIRMRAAVLSGLGLSTLHLILAWHLNNGDPFLWKQLGANVVLFLCTNAI
GVCTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKK
EDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLR
IKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHC
GVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYL
KEQCIETFLILGASQKRKEEKAMLVKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFRQM
GIDDSSKENRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYS
RKVDPRFGAYVACALLVFCFICFIQFLVFPHSALILGIYAGIFLLLLVTVLICAVCSCGS
FFPNALQRLSRSIVRSRVHSTAVGVFSVLLVFISAIANMFTCSHTPLRTCAARMLNLTPS
DVTACHLRQLNYSLGLEAPLCEGTAPTCSFPEYFVGSVLLSLLASSVFLHISSIGKLVMT
FVLGFIYLLLLLLGPPATIFDNYDLLLSVHGLASSNETFDGLDCPAVGRVALKYMTPVIL
LVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLA
RERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEE
RFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQ
MKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQ
LECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgtcatggtttagcggcctcctggttcccaaagtggatgaacggaaaacagcctggggc
gaacgcaatggacagaagcgcccacgccaggcgacccgagcccgtggcttctgcgcgccc
cgctacatgagctgcctcaagaatgtggagccacccagccccactcctgcagctcgcact
cggtgcccctggcaggatgaagccttcatcaggagggctggcccgggaaggggtgtggag
ctggggctgcggtcagtggccttgggttttgatgacactgaggtgaccacaccgatgggg
acagctgaagtggcacccgacacatcgcctcgaagcggtccgtcctgctggcaccggcta
gcgcaggtgttccagtctaagcagttccgctccgccaagctggagcgtctgtaccagcgg
tacttcttccagatgaaccagagcagcctcacgctgctcatggcggtgcttgtgctcctc
atggctgtactgttgaccttccacgccgcgcctgccctgcctcagcctgcttatgtggcc
ctgctgacctgtgcctccgtcctttttgtggtactcatggtagtgtgtaaccgacatagc
ttccgccaggactccatgtgggtagtgagctatgtggttctgggcatcctagcagccgtg
caagtcgggggtgccctggcagccaacccacgcagcccctcagcaggcctttggtgcccc
gtgttcttcgtctacatcacctacacacttcttcccattcgtatgcgagcggccgtgctc
agtggcctgggtctttccaccctgcatttgattttggcctggcatctcaacaatggtgac
cccttcctttggaagcagctcggtgctaacgtggtgctcttcctgtgcaccaatgccatc
ggtgtctgcacgcactaccccgctgaagtgtctcagcgccaagcctttcaggagacccgt
ggttacatccaggcccggctgcacttgcagcatgagaatcgacagcaggaacggctgctg
ctgtcggtgttgccccagcatgttgccatggaaatgaaagaggatatcaacacaaaaaag
gaagacatgatgttccacaagatttacatccagaagcatgacaatgtcagcatcctgttt
gccgacatcgagggcttcaccagcctggcctcccagtgcactgcccaggaactggtcatg
accttgaatgagctctttgcccggttcgacaagctggctgcggagaatcactgtctgagg
atcaagatcttaggagactgttactactgtgtgtcggggctgccggaggcccgggcagac
catgcccactgctgtgtggagatgggggtagacatgatcgaggccatctcgctggtgcgt
gaggtaacgggtgtaaatgtgaacatgcgcgtgggcatccacagcgggcgtgtacactgc
ggtgtccttggtctgcggaaatggcagtttgatgtctggtccaacgatgtgaccctggcc
aaccacatggaggcggggggccgggccggccgcatccacatcactcgggccacactgcag
tacctgaacggggactatgaggtggagccaggccgtggcggtgagcgcaacgcgtacctc
aaggagcagtgcattgagaccttcctcatactaggagccagccagaaacggaaagaggag
aaggccatgctggtcaagctgcagcggacgcgggccaactccatggaaggactgatgccc
cgctgggttcctgaccgtgccttctcccggaccaaggactctaaggcattccgacagatg
ggcatcgatgactctagcaaagagaaccggggtgcccaagatgctctgaaccctgaggat
gaggtggacgagtttctgggccgagccatcgatgcccgaagcatcgaccagctgcgtaag
gaccatgtgcgccggttcctgctcaccttccagagggaggatctcgagaagaagtattca
cggaaagtagaccctcgtttcggagcctacgtcgcctgtgccctcctggttttctgcttc
atctgtttcatccagttcctcgtattcccacactccgccctgatactcgggatttatgcc
gggatcttccttttgctgctggtcaccgtgctcatctgtgctgtgtgctcctgtgggtct
ttcttccccaacgccctgcagcgcctgtcccgcagtatcgtccgctcacgggtgcacagc
acggctgttggagtcttctcggttctgcttgtgttcatctctgccattgccaacatgttc
acctgcagtcacaccccactgaggacctgtgcggcccggatgctgaacttaacaccgtcc
gatgtcaccgcctgccacctacgacagctcaattactctctgggactggaagctcccctg
tgtgagggcaccgcacccacctgcagcttccctgagtactttgtcgggagtgtgctgctg
agtctcttggccagctccgtcttcctccacatcagcagcattggcaagctagttatgacc
tttgtcttggggttcatctacttgcttctgcttttgctgggtcccccagccaccatcttt
gacaactatgatctactgcttagcgtccatggcttggcttcctccaatgagaccttcgat
gggctggactgcccagccgtagggagggtagcgctcaaatacatgacccctgtgattctc
ctcgtgttcgccctggcactgtatctacacgcacaacaggtggaatctaccgcccgcctg
gacttcctgtggaaactgcaggccacaggggagaaggaggagatggaggagttgcaggcc
tacaaccggcggctgctgcataacatccttcccaaggacgtggctgcccacttcctggcc
cgggagcgccgcaacgacgagctgtactaccaatcctgcgagtgcgtggctgtcatgttt
gcctccatcgccaacttctctgagttctatgtggaactggaggcgaacaatgagggcgtg
gagtgcctgcgactgctcaatgagatcatcgcggactttgatgagatcatcagtgaggag
aggttccggcagctggagaagatcaagaccatcggtagcacttacatggccgcctccggg
ctaaatgccagcacctatgaccaggtcggccgctcgcacatcaccgccctggcagactac
gccatgcggcttatggagcaaatgaaacacatcaacgaacactctttcaacaacttccag
atgaagatcgggttgaacatgggtccggttgtagcaggtgtcattggggcccggaagcca
cagtatgacatctggggaaacacggtgaatgtttccagccgtatggacagcacaggagtt
cctgaccgaatacaggtgaccacggatctgtaccaggttctagctgccaagggctaccaa
ctggagtgtcgaggggtggtcaaggtgaagggaaagggggagatgaccacctacttcctc
aatgggggccccagcagttag

KEGG   Rattus norvegicus (rat): 29241
Entry
29241             CDS       T01003                                 

Gene name
Adcy8
Definition
(RefSeq) adenylate cyclase type 8
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno01522  Endocrine resistance
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04114  Oocyte meiosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04714  Thermogenesis
rno04720  Long-term potentiation
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04727  GABAergic synapse
rno04742  Taste transduction
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04921  Oxytocin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04976  Bile secretion
rno05032  Morphine addiction
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    29241 (Adcy8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    29241 (Adcy8)
   04371 Apelin signaling pathway
    29241 (Adcy8)
   04020 Calcium signaling pathway
    29241 (Adcy8)
   04072 Phospholipase D signaling pathway
    29241 (Adcy8)
   04024 cAMP signaling pathway
    29241 (Adcy8)
   04022 cGMP-PKG signaling pathway
    29241 (Adcy8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    29241 (Adcy8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    29241 (Adcy8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    29241 (Adcy8)
   04062 Chemokine signaling pathway
    29241 (Adcy8)
  09152 Endocrine system
   04911 Insulin secretion
    29241 (Adcy8)
   04923 Regulation of lipolysis in adipocytes
    29241 (Adcy8)
   04912 GnRH signaling pathway
    29241 (Adcy8)
   04913 Ovarian steroidogenesis
    29241 (Adcy8)
   04915 Estrogen signaling pathway
    29241 (Adcy8)
   04914 Progesterone-mediated oocyte maturation
    29241 (Adcy8)
   04921 Oxytocin signaling pathway
    29241 (Adcy8)
   04926 Relaxin signaling pathway
    29241 (Adcy8)
   04935 Growth hormone synthesis, secretion and action
    29241 (Adcy8)
   04918 Thyroid hormone synthesis
    29241 (Adcy8)
   04928 Parathyroid hormone synthesis, secretion and action
    29241 (Adcy8)
   04916 Melanogenesis
    29241 (Adcy8)
   04925 Aldosterone synthesis and secretion
    29241 (Adcy8)
   04927 Cortisol synthesis and secretion
    29241 (Adcy8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    29241 (Adcy8)
   04270 Vascular smooth muscle contraction
    29241 (Adcy8)
  09154 Digestive system
   04970 Salivary secretion
    29241 (Adcy8)
   04971 Gastric acid secretion
    29241 (Adcy8)
   04972 Pancreatic secretion
    29241 (Adcy8)
   04976 Bile secretion
    29241 (Adcy8)
  09156 Nervous system
   04724 Glutamatergic synapse
    29241 (Adcy8)
   04727 GABAergic synapse
    29241 (Adcy8)
   04725 Cholinergic synapse
    29241 (Adcy8)
   04720 Long-term potentiation
    29241 (Adcy8)
   04723 Retrograde endocannabinoid signaling
    29241 (Adcy8)
  09157 Sensory system
   04742 Taste transduction
    29241 (Adcy8)
   04750 Inflammatory mediator regulation of TRP channels
    29241 (Adcy8)
  09149 Aging
   04211 Longevity regulating pathway
    29241 (Adcy8)
   04213 Longevity regulating pathway - multiple species
    29241 (Adcy8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    29241 (Adcy8)
   04714 Thermogenesis
    29241 (Adcy8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29241 (Adcy8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    29241 (Adcy8)
   05163 Human cytomegalovirus infection
    29241 (Adcy8)
  09165 Substance dependence
   05032 Morphine addiction
    29241 (Adcy8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    29241 (Adcy8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    29241 (Adcy8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    29241 (Adcy8)
Enzymes [BR:rno01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     29241 (Adcy8)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Other DBs
NCBI-GeneID: 29241
NCBI-ProteinID: NP_058838
RGD: 2036
Ensembl: ENSRNOG00000004890
UniProt: P40146
Position
7
AA seq 1248 aa
MELSDVHCLSGSEELYTIHPTPPAADGGSGSRPQRLLWQTAVRHITEQRFIHGHRGGGGG
GSRKASNPAGSGPNHHAPQLSSDSVLPLYSLGSGERAHNTGGTKVFPERSGSGSASGSGG
GGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRKSEV
VMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSHTYLQ
YSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGTSLLQ
VTLQVLIPRLAVFSINQVLAQVVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRL
ETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGF
TNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAHCCV
EMGLSMIKTIRFVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESG
GIPGRIHISKATLDCLSGDYNVEEGHGKERNEFLRKHNIETYLIKQPEESLLSLPEDIVK
ESVSCSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSG
PEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAFIVL
LFITAIQSLLPSSRLMPMTIQFSILIMLHSALVLITTAEDYKCLPLILRKTCCWINETYL
ARNVIIFASILINFLGAVINILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTGVLA
MVTCAVFLRLNSVLKLAVLLIMIAIYALLTETIYAGLFLSYDNLNHSGEDFLGTKEASLL
LMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKDLREHNENMLRNILPGHVARHF
LEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLG
EDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSFN
NFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLILKDQ
GFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQSL
NRQRQKQLLNENSNSGIIKSHYNRRTLLTPSGPEPGAQAEGTDKSDLP
NT seq 3747 nt   +upstreamnt  +downstreamnt
atggaactctcggatgtgcactgccttagcggcagcgaggaactctataccattcacccg
acgcccccggccgcggacggcgggagcggctctcggccgcagcggctgctgtggcagacg
gcggtgcggcacatcaccgagcagcgcttcatccacggccaccgaggcggcggcggcggg
ggctcccgcaaagcctcgaaccctgcgggcagcggaccaaaccaccacgcgccgcagctg
tctagcgactcggtgctgcctctctattctctgggctccggagagcgagcgcacaacacc
ggtggcaccaaagtctttccggaacgcagcgggagcggcagtgccagtggcagcgggggt
gggggcgacttgggcttcctgcaccttgactgtgccccaagtaactcggatttcttcctc
aatgggggatacagctaccgtggggtcattttcccaaccctacgcaactccttcaagtct
cgggatctggagcgcctctatcaacgctatttcctgggccagaggcgcaaatcggaggta
gtgatgaacgtgctggatgtactaaccaaactcacccttctagtccttcacttgagccta
gcctcggctcccatggaccctctcaagggcatcctgctaggctttttcactggcatcgag
gtggtgatctgcgccctcgtggtggtcaggaaggacaccacctcccacacttacctgcaa
tacagcggcgtggtcacttgggtggctatgaccacccagattctggcagcaggcctgggc
tatgggcttctgggcgacggcataggctacgtgctttttacactcttcgccacctacagc
atgcttccgctgcctctcacctgggccatcttggccggcctgggcacatccttgctgcaa
gtcacacttcaagtgctcatacccagactagcggtcttttccatcaaccaggtcctggcc
caggtggtgctcttcatgtgcatgaatacagcaggcatcttcatcagttacctttcagac
cgcgcccagcggcaggccttcctggagacccggaggtgtgtggaggccaggctccgcctg
gagacagagaaccaaagacaggagcggcttgtgctctctgtgctccccaggtttgtcgtc
ctagaaatgatcaatgacatgaccaatgtggaggacgagcacctgcagcatcagttccac
cgcatctacatccatcgctacgagaacgtcagtattctttttgcagatgtcaaaggattt
accaacctctctacgaccttgtctgctcaggagcttgtcaggatgctcaacgagctcttt
gccagatttgatcggctggcccatgagcatcactgtcttcgcattaaaatcctgggggac
tgctactactgtgtgtcaggactgcctgagccccgccaggaccatgctcattgctgtgtt
gaaatgggcctcagcatgatcaaaactatcaggtttgtgaggtccagaacgaagcatgat
gttgacatgcgaattggaatccattcaggctctgtgctgtgtggtgtgttgggcctgaga
aaatggcagtttgatgtctggtcttgggatgtggacatcgcaaacaaacttgaatctgga
ggaatccctgggagaattcacatttccaaagccacactggattgcctcagtggtgactat
aatgtggaagagggccacggtaaggagaggaatgaattcttgaggaagcataatatagag
acctatttgattaagcagcccgaggagagtttgctatccttgcctgaagatatagttaag
gagtcggtgagctgctcggacaggagaaacagtggggcaacgttcacagaaggatcctgg
agcccagaactgccattcgacaacatcgtgggcaaacagaatactctggctgccctaaca
agaaattcaataaatctgcttccaaaccatctcgcacaagctttgcatgtccagtctggg
cctgaggaaattaacaagagaatagagcataccatcgacttgcggagtggcgataagttg
agaagagagcatatcaagccattctcactgatgtttaaagactccagcctggagcacaag
tattctcaaatgcgggatgaagtattcaagtcaaacttggtctgtgcatttatcgttctt
ctgtttatcactgcgattcaaagtttgcttccttcttcgaggctgatgcctatgaccatc
cagttctccatcctgatcatgctgcactccgccctggtcctcatcaccacggcagaagac
tataagtgtctgcctctcattctccgcaaaacctgttgttggattaacgagacctatttg
gcccgcaacgtcatcatctttgcttccatcttgattaatttcctgggagccgtcataaat
attctgtggtgtgattttgacaagtcgatacccttgaagaacctgactttcaattcctca
gctgtgtttacagatatctgctcctacccagagtactttgtcttcactggggtgttggcc
atggtgacgtgtgcagtatttctccggcttaactctgtcctgaagctggctgtgctgctc
attatgatcgccatctacgccctgctgacagagaccatctatgcaggtctctttctgagt
tatgacaacctgaaccacagtggagaagattttctggggaccaaggaggcatcactgcta
ctgatggccatgttccttcttgctgtattctaccatggacagcagctggagtacacagcc
cgcctagatttcctgtggcgagtacaggccaaagaggagatcaacgagatgaaggacttg
agggaacacaatgagaacatgcttcgcaatatcttacccggccacgtggcccgccacttc
ctggagaaagacagagacaatgaggagctgtattctcaatcctatgatgccgttggggta
atgtttgcctccattcctggatttgcagacttttactctcagacagaaatgaacaaccag
ggagtggaatgtctgcgcttgctgaatgagatcattgctgactttgatgagttacttgga
gaggaccgctttcaggacatagagaagattaagaccattggtagtacatacatggctgtc
tcaggactgtcaccagagaaacagcaatgtgaagataaatggggacatttgtgtgccctg
gctgacttctctcttgccctgactgaaagcatacaagagatcaacaagcattcgttcaac
aattttgaactccgtattggcatcagccatggctcagtggtagcaggtgtaattggcgct
aagaaaccacagtatgacatttggggtaaaactgtgaacttggcaagccgaatggacagc
acaggagtgagtggccggatccaagttcctgaggagacctatctcatcctgaaggatcag
ggctttgccttcgactaccggggagagatatatgtgaagggcatcagcgaacaagaaggg
aaaatcaaaacatattttctcctgggacgagtccaacccaacccattcatcttaccccca
agaagacttcctgggcagtactctctggctgcagttgtccttgggcttgtccagtctctc
aacaggcaaaggcagaagcaactactcaatgagaacagcaactctggcatcatcaagagc
cattacaaccggcggactttgctaacgccaagtgggccagagcctggagcacaggctgaa
ggcactgacaaatccgatttgccataa

KEGG   Rattus norvegicus (rat): 302950
Entry
302950            CDS       T01003                                 

Gene name
Adcy9
Definition
(RefSeq) adenylate cyclase type 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno01522  Endocrine resistance
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04114  Oocyte meiosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04727  GABAergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04921  Oxytocin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04962  Vasopressin-regulated water reabsorption
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04976  Bile secretion
rno05032  Morphine addiction
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    302950 (Adcy9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    302950 (Adcy9)
   04371 Apelin signaling pathway
    302950 (Adcy9)
   04020 Calcium signaling pathway
    302950 (Adcy9)
   04072 Phospholipase D signaling pathway
    302950 (Adcy9)
   04024 cAMP signaling pathway
    302950 (Adcy9)
   04022 cGMP-PKG signaling pathway
    302950 (Adcy9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    302950 (Adcy9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    302950 (Adcy9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    302950 (Adcy9)
   04062 Chemokine signaling pathway
    302950 (Adcy9)
  09152 Endocrine system
   04911 Insulin secretion
    302950 (Adcy9)
   04923 Regulation of lipolysis in adipocytes
    302950 (Adcy9)
   04912 GnRH signaling pathway
    302950 (Adcy9)
   04913 Ovarian steroidogenesis
    302950 (Adcy9)
   04915 Estrogen signaling pathway
    302950 (Adcy9)
   04914 Progesterone-mediated oocyte maturation
    302950 (Adcy9)
   04921 Oxytocin signaling pathway
    302950 (Adcy9)
   04926 Relaxin signaling pathway
    302950 (Adcy9)
   04935 Growth hormone synthesis, secretion and action
    302950 (Adcy9)
   04918 Thyroid hormone synthesis
    302950 (Adcy9)
   04928 Parathyroid hormone synthesis, secretion and action
    302950 (Adcy9)
   04916 Melanogenesis
    302950 (Adcy9)
   04925 Aldosterone synthesis and secretion
    302950 (Adcy9)
   04927 Cortisol synthesis and secretion
    302950 (Adcy9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    302950 (Adcy9)
   04270 Vascular smooth muscle contraction
    302950 (Adcy9)
  09154 Digestive system
   04970 Salivary secretion
    302950 (Adcy9)
   04971 Gastric acid secretion
    302950 (Adcy9)
   04972 Pancreatic secretion
    302950 (Adcy9)
   04976 Bile secretion
    302950 (Adcy9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    302950 (Adcy9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    302950 (Adcy9)
  09156 Nervous system
   04724 Glutamatergic synapse
    302950 (Adcy9)
   04727 GABAergic synapse
    302950 (Adcy9)
   04725 Cholinergic synapse
    302950 (Adcy9)
   04723 Retrograde endocannabinoid signaling
    302950 (Adcy9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    302950 (Adcy9)
  09149 Aging
   04211 Longevity regulating pathway
    302950 (Adcy9)
   04213 Longevity regulating pathway - multiple species
    302950 (Adcy9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    302950 (Adcy9)
   04714 Thermogenesis
    302950 (Adcy9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    302950 (Adcy9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    302950 (Adcy9)
   05163 Human cytomegalovirus infection
    302950 (Adcy9)
  09165 Substance dependence
   05032 Morphine addiction
    302950 (Adcy9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    302950 (Adcy9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    302950 (Adcy9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    302950 (Adcy9)
Enzymes [BR:rno01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     302950 (Adcy9)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF512 zf-C2HC_2
Other DBs
NCBI-GeneID: 302950
NCBI-ProteinID: NP_001358619
RGD: 1304747
Ensembl: ENSRNOG00000049768
Vega: OTTRNOG00000000982
Position
10
AA seq 1354 aa
MASSPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNTHPKHCKYSISSSCSSSGDS
GGLPRRVGGGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACLERCFPQTQRRFRYAL
FYVGFACLLWSIYFAVHMRSKVIVMVVPALCFLVVCVGFFLFTFTKLYARHYAWTSLALT
LLVFALTLAAQFQVWTPLSGRVDSPNHTLTAKAADTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLFLGVVYSVLFETFGYHFRNEDCFPSPDPGALHWELLSRALLHVCIHAIGIHLFV
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKASIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGRVMERLGQSVVADQLKGLKTYLISGQRAKESHCSCAEALLSGFEVIDDSRVS
SGPRGQGTASPGSVSDLAQTVKTFDNLKTCPSCGITFAPKSEAGAEGGAVQNGCQDEPKA
STKASGGPNSKTQNGLLSPPAEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPISQFSLNFLDQELEQSYRASYQEEVIKNSPVKTF
ASATFSSLLDVFLSTTVFLILSITCFLKYGATATPPPPAALAVFGADLLLEVLSLIVSIR
MVFFLEDVLTCTKRLLEWIAGWLPRHCIGAILVSLPALAVYSHITSEFETNINFTMLTGS
AVLVAVVHYCNFCQLSSWMRSSLATLVGAGPLLLLYISLCQDSSIVMSPLDTAQNFSASE
RSPCNSSVLQDGRRPASLIGKELILTFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRT
KIQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGK
ECYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGLNTAQCQEGGHPQEHLRILF
EFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDT
TGVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCTDNGVVPQHQLSIS
PDIRVQVDGSIGRSPTDEITNLVPSVQYLDKASLGSDDGAQTKEATLSSKRPWREPVKAE
ERFRFGKAIEKEDCEDTGAEEANELTKLNVSKSV
NT seq 4065 nt   +upstreamnt  +downstreamnt
atggcttcctcaccccaccagcagctgctgcatcaccatagcaccgaggtgagctgcgac
tcaagcggagacagcaacagcgtgagggtcaagatcaaccctaagcagctgtcctccaac
acccacccgaagcactgcaagtacagcatctcctccagctgtagcagctcgggagactca
gggggccttccccggcgggtgggcggcgggggtcgcctgcgaagacagaagaagctgccc
cagctgttcgagagggcctccagccggtggtgggaccccaaattcgactccgtgaacctg
gaggaggcctgcctggagcgctgctttccgcagacccagcgccgcttccggtacgcactc
ttttatgtgggcttcgcctgccttctctggagcatctatttcgctgtccacatgagatcc
aaagtgattgtcatggtggtcccggctctgtgcttcctggtggtatgtgtgggctttttc
ctgtttactttcaccaagctgtacgcccggcattatgcgtggacctcgctggctctcacc
ctgctggtgttcgccctgaccctggctgcgcagtttcaggtttggacacctctgtcggga
cgtgttgacagccccaatcatactctcacggccaaggcggcggacacttgcttatctcaa
gtggggagcttctccatgtgcatcgaagtgctctttttgctttacacggtcatgcattta
cctctgtacctgagcttgtttttgggggtggtctattctgtcctttttgagaccttcggt
taccatttccgaaatgaagactgctttccttccccggaccccggggccctgcactgggag
ctgctgagcagagccctgctccacgtgtgcatccatgccattgggatccatctgtttgtc
atgtctcaggtgaggtccaggagcaccttcctcaaggtaggacaatccattatgcacggc
aaagatctggaagtagagaaagccctgaaggagaggatgattcactccgtgatgccgaga
atcatagctgacgacttaatgaagcagggggatgaggagagcgagaattctgtcaagagg
cacgccacctccagtcccaagaacaggaagaagaaggcctccatccagaaagcgcccata
gcattccgcccctttaagatgcagcagattgaagaagtcagtattttatttgcagacatc
gtggggttcaccaagatgagtgctaacaaatctgctcacgccttggtagggctactcaat
gatctgttcggccgcttcgaccggttgtgcgaggagaccaagtgtgaaaagatcagcacc
ctgggagactgttactactgtgtggcagggtgtccggagccccgggcagaccatgcctac
tgctgtatcgagatgggcttaggcatgataaaagccatcgagcagttctgccaggagaag
aaagagatggtgaacatgcgagtcggggttcacacggggacggtcttgtgtggcatcctg
ggcatgaggaggtttaaatttgatgtgtggtccaatgatgtgaacttggctaacctcatg
gagcagctgggagtggccggcaaagtccacatatccgaggccactgcaaaatacttagac
gacaggtacgaaatggaagatgggagagttatggagcgtcttgggcagagtgtggtcgct
gaccagttgaaaggtttgaagacatacctgatatcgggtcagagagccaaggagtcccac
tgcagctgtgcagaggccctgctttctggctttgaggtcattgacgactcacgggtgtcc
tcaggccctaggggacaggggacagcatcgccagggagtgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacttgcccttcatgtggaatcacatttgctcccaaa
tctgaagctggtgcagaaggaggagctgtgcaaaatggctgtcaagacgagcctaaggcc
agcaccaaggcttctggaggacccaactccaaaacccagaacggactcctgagccctcct
gcagaggagaagctcaccaacagccagacctccctctgtgagatactgcaggagaaggga
cggtgggcaggcgtgagcttggaccagtcagccctcctcccgctcaggttcaagaacatc
cgtgagaaaactgacgcccactttgtcgatgtcatcaaagaagacagcctgatgaaagat
tatttcttcaagccgcccatcagtcagttcagcctgaacttcctggaccaggagctggag
caatcctacagagccagctaccaggaagaggtcataaagaactctcccgtgaagacgttt
gccagtgccaccttcagctcccttctggatgtgtttctgtcaaccacggtgttcctgatt
ctctccatcacctgcttcctaaagtacggagccaccgccacccctcccccaccggctgcc
ctggccgtctttggtgcagacctgctgctggaggtgctttctctcatagtgtccatcaga
atggtgttcttcctggaggatgtcctgacgtgtacaaagcgcttgctggaatggatcgct
ggctggctccctcgccactgcattggggccatcttggtgtcacttcctgccctggctgtc
tattcacacatcacctccgagtttgagaccaacataaatttcaccatgctcacgggctct
gcagtgctggtggccgtcgtgcactactgtaacttctgccagctcagctcctggatgagg
tcctccctcgccacccttgtgggggctgggccgctgcttctgctctacatctcgctatgc
caggacagttccattgtgatgtcacccttggacacagcacagaatttcagtgcctccgag
aggagcccgtgcaacagctcagtgctgcaggacggcaggaggccggccagcctcataggc
aaggagctcatcctcaccttcttcctcctgctcctcttggtctggttcctgaaccgggag
ttcgaggtgagctaccggctgcactaccacggggatgtggaagcagacctacaccgcacc
aagatccagagcatgagagaccaggccgactggctgctacggaacatcatcccctaccac
gtggcggagcagctcaaggtctcgcagacctactccaagaaccatgacagcgggggagtg
atctttgccagcatcgtcaacttcagtgaattctacgaggagaactatgaggggggcaag
gaatgctaccgcgtcctcaatgagctgatcggtgacttcgacgagctcttgagcaagccg
gactataatagcatcgagaagatcaagaccatcggggccacgtatatggcagcctcgggg
ctgaacacggcccagtgccaggagggcggccacccacaggagcacctgcgtatcctcttc
gagttcgccaaggagatgatgcgcgtggtggatgacttcaacaacaacatgctctggttc
aacttcaagctcagggtcggcttcaaccacgggcccctcacggcaggtgtcatcggcacc
accaagctgctgtatgacatctggggggacaccgtcaacatcgccagcaggatggacacc
accggggtggagtgccgaatccaggtgagcgaggagagctaccgcgtgctgagcaagatg
ggttacgactttgactaccgagggaccgtgaacgtcaaggggaaagggcagatgaagaca
tacctttacccgaagtgcacggacaatggagtggtccctcagcaccagctgtccatctcc
ccggacatccgcgtccaggtggacggcagcattgggcggtctcccacagatgagatcacc
aacttggtgccttctgttcagtatctggacaaggcttccctggggtctgacgatggggcg
cagaccaaggaagcgaccctgtcctctaagaggccctggagagagccagtcaaagcagag
gagaggtttcgatttggcaaagccatagagaaggaagactgtgaagacacaggcgcagaa
gaggccaatgaactcaccaagctcaacgtctcaaagagtgtgtga

KEGG   Rattus norvegicus (rat): 305509
Entry
305509            CDS       T01003                                 

Gene name
Adcy1
Definition
(RefSeq) adenylate cyclase type 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno01522  Endocrine resistance
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04114  Oocyte meiosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04714  Thermogenesis
rno04720  Long-term potentiation
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04727  GABAergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04921  Oxytocin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04976  Bile secretion
rno05032  Morphine addiction
rno05142  Chagas disease
rno05146  Amoebiasis
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    305509 (Adcy1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    305509 (Adcy1)
   04371 Apelin signaling pathway
    305509 (Adcy1)
   04020 Calcium signaling pathway
    305509 (Adcy1)
   04072 Phospholipase D signaling pathway
    305509 (Adcy1)
   04024 cAMP signaling pathway
    305509 (Adcy1)
   04022 cGMP-PKG signaling pathway
    305509 (Adcy1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    305509 (Adcy1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    305509 (Adcy1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    305509 (Adcy1)
   04062 Chemokine signaling pathway
    305509 (Adcy1)
  09152 Endocrine system
   04911 Insulin secretion
    305509 (Adcy1)
   04923 Regulation of lipolysis in adipocytes
    305509 (Adcy1)
   04912 GnRH signaling pathway
    305509 (Adcy1)
   04913 Ovarian steroidogenesis
    305509 (Adcy1)
   04915 Estrogen signaling pathway
    305509 (Adcy1)
   04914 Progesterone-mediated oocyte maturation
    305509 (Adcy1)
   04921 Oxytocin signaling pathway
    305509 (Adcy1)
   04926 Relaxin signaling pathway
    305509 (Adcy1)
   04935 Growth hormone synthesis, secretion and action
    305509 (Adcy1)
   04918 Thyroid hormone synthesis
    305509 (Adcy1)
   04928 Parathyroid hormone synthesis, secretion and action
    305509 (Adcy1)
   04916 Melanogenesis
    305509 (Adcy1)
   04925 Aldosterone synthesis and secretion
    305509 (Adcy1)
   04927 Cortisol synthesis and secretion
    305509 (Adcy1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    305509 (Adcy1)
   04270 Vascular smooth muscle contraction
    305509 (Adcy1)
  09154 Digestive system
   04970 Salivary secretion
    305509 (Adcy1)
   04971 Gastric acid secretion
    305509 (Adcy1)
   04972 Pancreatic secretion
    305509 (Adcy1)
   04976 Bile secretion
    305509 (Adcy1)
  09156 Nervous system
   04724 Glutamatergic synapse
    305509 (Adcy1)
   04727 GABAergic synapse
    305509 (Adcy1)
   04725 Cholinergic synapse
    305509 (Adcy1)
   04720 Long-term potentiation
    305509 (Adcy1)
   04723 Retrograde endocannabinoid signaling
    305509 (Adcy1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    305509 (Adcy1)
  09149 Aging
   04211 Longevity regulating pathway
    305509 (Adcy1)
   04213 Longevity regulating pathway - multiple species
    305509 (Adcy1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    305509 (Adcy1)
   04714 Thermogenesis
    305509 (Adcy1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    305509 (Adcy1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    305509 (Adcy1)
   05163 Human cytomegalovirus infection
    305509 (Adcy1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    305509 (Adcy1)
   05142 Chagas disease
    305509 (Adcy1)
  09165 Substance dependence
   05032 Morphine addiction
    305509 (Adcy1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    305509 (Adcy1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    305509 (Adcy1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    305509 (Adcy1)
Enzymes [BR:rno01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     305509 (Adcy1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA TBK1_ULD
Other DBs
NCBI-GeneID: 305509
NCBI-ProteinID: NP_001100709
RGD: 1309318
Ensembl: ENSRNOG00000059479
UniProt: D4A3N4
Position
14
AA seq 967 aa
MGSAVAEQGVWQLLLVTFVSYALLPVRSLLAIGFGLVVAASHLLVTAALVPAKRPRLWRT
LGANALLFFGVNMYGVFVRILTERSQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPR
NVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFG
KFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDL
NMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYE
VEPGHGHERNTFLRTHNIETFFIVPSHRRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMH
CRKMFKAEIPFSNVMTCEDDDKRRALRTASEKLRNRSSFSTNVVYTTPGTRVNRYISRLL
EARQTELEMADLNFFTLKYKHVEREQKYHQLQDEYFTSAVVLALILATLFGLIYLLVIPQ
SVAVLLLLVFSICFLVACTLYLHITRVQCFPGCLTIQIRTALCVFIVVLIYSVAQGCVVS
CLPWAWSSHSNSSLVVLAAGGRRTVLPALPCESAHHGLLCCLVGTLPLAIFLRVSSLPKM
ILLSGLTTSYILVLELSGYTKVGGGALSGRSYEPIMAILLFSCTLALHARQVDVRLRLDY
LWAAQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFAS
IPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMDKDFYKDLEKIKTIGSTYMAAVGLA
PTAGTRAKKSISSHLSTLADFAIDMFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARR
PQYDIWGNTVNVASRMDSTGVQGRIQVTEEVHRLLNRCSYQFVCRGKVSVKGKGEMLTYF
LEGRTDGSSSHSRSLRLERRMFPYGRGGGGQARRPPLCPAAGPPIKPGLSPAPTSQYLSS
TAAGKEA
NT seq 2904 nt   +upstreamnt  +downstreamnt
atgggctcggcggttgccgaacagggggtttggcaactccttttggtcaccttcgtgtcc
tatgccttgctgcccgtgcgcagcctactggccatcggcttcgggctcgtggtggctgcc
tcgcacttactggtcacagccgccttggtccctgccaagcgcccacgtctctggaggacg
cttggtgccaatgccctgctcttctttggtgtgaacatgtatggcgtcttcgtgcggatc
ttgactgagcgctcccagaggaaggccttcctgcaggctcgaaactgcattgaggaccgg
ctgcggctggaagatgagaatgagaaacaggagcggttgctcatgagcctcttgccccgg
aatgtcgccatggagatgaaggaagacttcctgaagccccctgagaggatatttcacaag
atttacatccagaggcacgacaatgtgagcatcctgtttgcagacatcgtgggtttcaca
ggtctggcgtcccagtgcacggcccaggagctggtgaaactgctcaatgaactctttggc
aagttcgatgagttagccacggaaaaccactgtcgccgaatcaagatccttggagactgc
tactactgtgtgtctggcctcacccagcccaagacggatcacgcccactgctgtgtggag
atgggacttgacatgatcgataccatcacatccgtggctgaggctactgaagtagacctg
aacatgcgtgtgggcctacacactggcagggtcctctgtggtgtcctgggcctacgcaag
tggcagtacgacgtatggtccaacgacgtcaccctggccaatgtcatggaggctgctggc
ttaccagggaaggtccacatcacgaagacaacccttgcgtgcttgaacggggactacgag
gtggagccgggccacggccatgagaggaacacctttctgagaactcacaacatcgagacc
ttctttattgtgccatcccatcggaggaagatatttccaggtttgattctctcggatatc
aaaccagccaagaggatgaagttcaagaccgtctgctacctgctggtgcagctcatgcat
tgccggaaaatgttcaaggctgagatccccttctccaacgtaatgacctgtgaggatgat
gacaagcgaagggcattgagaacggcctcggagaagctcagaaaccgttcgtcattctct
accaacgtggtctacaccactccgggtacgcgtgtcaacaggtacatcagccgccttctt
gaagcccgccagacagagctggagatggccgacctgaacttctttaccctcaagtacaag
catgttgaacgggaacaaaaataccaccagcttcaagatgagtacttcaccagcgccgtt
gtcctcgccctcatcctggctaccttatttgggcttatctaccttctggtaatcccacag
agcgtggctgtcctgctgctgctggtgttttctatctgcttcttggtggcctgtaccctg
tacctgcacatcacgagggtccagtgttttccagggtgcctgaccatccagatccgcacc
gctctgtgtgtgttcatcgtggtcttaatctactcagtagctcaaggatgtgtggtgagc
tgtctgccttgggcctggagctctcactccaacagctccctagtggtcctcgcagctggt
ggccggcgcactgtgctgcctgccctgccctgtgagtctgcacaccatggcctgctctgc
tgcctggtgggcaccctcccactagccatattcctgcgggtgtcctccttgccaaagatg
atcctgctgtctgggctgacgacttcctacatccttgtcctggagctcagtggatacacc
aaggttgggggcggtgccctctctgggcgcagctatgagcccatcatggctatcctgctg
ttctcatgcacgctggccctgcacgccaggcaggtggacgtcaggctacggctggactac
ctctgggcagcacaggcggaggaggaacgggacgacatggagagggtaaagctggacaac
aagaggatcctcttcaacctcctgccagcgcacgtcgcacagcacttcctcatgtccaat
ccccggaacatggatctctattaccagtcctactcccaggtgggcgtcatgttcgcctcc
atccccaacttcaacgacttctacatagaactggatggcaacaacatgggcgttgagtgt
ctgcggctcctcaatgagatcattgctgactttgatgagctcatggacaaggacttctac
aaggacctggagaagatcaagaccattgggagtacctatatggctgccgtggggctggcg
cccacagcaggaaccagggctaagaagtccatctcttcccatctgagcacgctggcagac
tttgccatcgacatgtttgatgtcctggatgagatcaactaccagtcctacaacgacttc
gttctccgagtcggcatcaacgttggccccgtggtcgctggagtgatcggtgctcgcagg
ccccagtacgacatctggggaaacacagtcaatgtggccagtcggatggatagcactggg
gtccagggaagaattcaggtgactgaggaagtccaccgactgctgaacaggtgctcatac
cagtttgtgtgcagaggcaaagtcagcgtcaagggcaagggagagatgctaacgtacttt
ctagaaggcaggactgatgggagcagttcccacagcaggtcccttcgcttggagcgaagg
atgtttccttatgggagaggcggcggaggccaggccaggcggcccccattgtgtcctgca
gctggacccccaatcaaaccggggctctctccagcccccactagccagtacctgtcatcc
acagcagcagggaaggaagcctag

KEGG   Rattus norvegicus (rat): 54223
Entry
54223             CDS       T01003                                 

Gene name
Adcy4
Definition
(RefSeq) adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno01522  Endocrine resistance
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04114  Oocyte meiosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04727  GABAergic synapse
rno04742  Taste transduction
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04921  Oxytocin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04976  Bile secretion
rno05032  Morphine addiction
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    54223 (Adcy4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    54223 (Adcy4)
   04371 Apelin signaling pathway
    54223 (Adcy4)
   04020 Calcium signaling pathway
    54223 (Adcy4)
   04072 Phospholipase D signaling pathway
    54223 (Adcy4)
   04024 cAMP signaling pathway
    54223 (Adcy4)
   04022 cGMP-PKG signaling pathway
    54223 (Adcy4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    54223 (Adcy4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    54223 (Adcy4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    54223 (Adcy4)
   04062 Chemokine signaling pathway
    54223 (Adcy4)
  09152 Endocrine system
   04911 Insulin secretion
    54223 (Adcy4)
   04923 Regulation of lipolysis in adipocytes
    54223 (Adcy4)
   04912 GnRH signaling pathway
    54223 (Adcy4)
   04913 Ovarian steroidogenesis
    54223 (Adcy4)
   04915 Estrogen signaling pathway
    54223 (Adcy4)
   04914 Progesterone-mediated oocyte maturation
    54223 (Adcy4)
   04921 Oxytocin signaling pathway
    54223 (Adcy4)
   04926 Relaxin signaling pathway
    54223 (Adcy4)
   04935 Growth hormone synthesis, secretion and action
    54223 (Adcy4)
   04918 Thyroid hormone synthesis
    54223 (Adcy4)
   04928 Parathyroid hormone synthesis, secretion and action
    54223 (Adcy4)
   04916 Melanogenesis
    54223 (Adcy4)
   04925 Aldosterone synthesis and secretion
    54223 (Adcy4)
   04927 Cortisol synthesis and secretion
    54223 (Adcy4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    54223 (Adcy4)
   04270 Vascular smooth muscle contraction
    54223 (Adcy4)
  09154 Digestive system
   04970 Salivary secretion
    54223 (Adcy4)
   04971 Gastric acid secretion
    54223 (Adcy4)
   04972 Pancreatic secretion
    54223 (Adcy4)
   04976 Bile secretion
    54223 (Adcy4)
  09156 Nervous system
   04724 Glutamatergic synapse
    54223 (Adcy4)
   04727 GABAergic synapse
    54223 (Adcy4)
   04725 Cholinergic synapse
    54223 (Adcy4)
   04723 Retrograde endocannabinoid signaling
    54223 (Adcy4)
  09157 Sensory system
   04742 Taste transduction
    54223 (Adcy4)
   04750 Inflammatory mediator regulation of TRP channels
    54223 (Adcy4)
  09149 Aging
   04211 Longevity regulating pathway
    54223 (Adcy4)
   04213 Longevity regulating pathway - multiple species
    54223 (Adcy4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    54223 (Adcy4)
   04714 Thermogenesis
    54223 (Adcy4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    54223 (Adcy4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    54223 (Adcy4)
   05163 Human cytomegalovirus infection
    54223 (Adcy4)
  09165 Substance dependence
   05032 Morphine addiction
    54223 (Adcy4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    54223 (Adcy4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    54223 (Adcy4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    54223 (Adcy4)
Enzymes [BR:rno01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     54223 (Adcy4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 54223
NCBI-ProteinID: NP_062158
RGD: 2034
Ensembl: ENSRNOG00000020401
UniProt: Q66HK5
Position
15
AA seq 1072 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLILLLVIVLCAIVALPAVAWASGRELTSDPS
FLTTVLCALGGFSLLLGLASREQQLQRWTRPLSGLIWAALLALGYGFLFTGGVVSAWDQV
SFFLFIIFTVYAMLPLGMRDAAAAGVISSLSHLLVLGLYLGWRPESQRDLLPQLAANAVL
FLCGNVVGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQSSRPENTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRVATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVERADMEHRDPYLRELGEPTYLVIDPWAEEEDEKGTERGLLSSLEGHTMRPSLLMTR
YLESWGAAKPFAHLSHVDSPASTSTPLPEKAFSPQWSLDRSRTPRGLHDELDTGDAKFFQ
VIEQLNSQKQWKQSKDFNLLTLYFREKEMEKQYRLSALPAFKYYAACTFLVFLSNFTIQM
LVTTRPPALATTYSITFLLFLLLLFVCFSEHLTKCVQKGPKMLHWLPALSVLVATRPGLR
VALGTATILLVFTMAVVSLLFLPVSSDCPFLAPNVSSVAFNTSWELPASLPLISIPYSMH
CCVLGFLSCSLFLHMSFELKLLLLLLWLVASCSLFLHSHAWLSDCLIARLYQGSLGSRPG
VLKEPKLMGAIYFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRLLLE
NVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASIPDFKEFYSESNINHEGLECLRLLN
EIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATPGQDTQQDAERSCSHLGTMVEFA
VALGSKLGVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVL
GKIQVTEETARALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGSPSAS
NT seq 3219 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagtccccggcctcctcccagcgaagatctcttctacgagacttac
tacagcctgagccaacagtatccactgctaattctgcttctggtcattgtgctctgcgcg
atcgtggcactgcccgccgtcgcctgggccagcggcagggagctgacctcagacccaagc
ttcctgacaactgtgctgtgtgctttgggtggcttctccctgcttttggggctcgcttcc
cgggagcagcaactgcagcgatggacacgacctctttctggcctcatatgggctgcattg
ctggctctgggctatgggtttctattcactgggggtgtggtgagcgcctgggatcaggtg
tcctttttcctcttcatcattttcaccgtgtacgccatgctgcccttgggcatgcgggat
gctgctgccgcgggggtcatctcatccctctcacacctgctggtccttggactgtacctt
gggtggcggcctgagtcgcagagggatctgctaccacagttggcagcgaatgcggtgttg
ttcctgtgtgggaacgtggtgggagcataccacaaggccctgatggagcgagcattgcgc
gccacgttccgggaggctcttagctccctgcattcacgccggaggttggacactgagaaa
aagcaccaggagcacctcctcttgtctatccttcctgcctacctggcccgagagatgaag
gcagagatcatggctcggctgcaggctggacagagctcacggccagagaacacaaacaac
tttcacagcctgtatgtcaagaggcaccaaggagtgagtgtgctgtatgctgacatcgtg
ggcttcacacggctggccagtgagtgttcccctaaggagctggtgctaatgctcaatgaa
ctcttcggcaaattcgaccaaattgcaaaggagcacgaatgcatgcggatcaagatcctg
ggagactgttactactgtgtatccgggctgcccctctctctgcctgaccacgccatcaat
tgcgtgcgcatgggactggacatgtgccgggccatcaggaaacttcgggtagccaccggt
gtggatatcaacatgcgtgtcggtgtgcactcaggcagcgtcctctgtggagtcatcggg
ctacagaagtggcagtatgatgtctggtcccatgatgtcacattggccaaccatatggaa
gcaggcggcgttccaggacgagtgcacatcacaggggccacgctggccctgctggcagga
gcttatgctgtggagagagcagacatggagcatcgagacccataccttcgggagctaggg
gaacccacatacctggtcattgatccttgggctgaggaggaagacgagaagggcaccgag
agaggattgctgtcttctctagaggggcacacgatgcgtccgtcactactgatgactcgt
tatctggagtcttggggtgcagccaagcctttcgcccacctaagccacgtcgacagtcct
gcatccacatccactccactcccggagaaagccttcagcccccagtggagcctggaccgg
agtcgcaccccccgcgggctacacgatgaactggacactggagatgccaagttcttccag
gtcatcgaacaactcaactctcaaaaacagtggaaacagtcgaaggacttcaacctcctg
acgctctacttcagagagaaggagatggagaaacagtatcggctgtctgcgctccccgcc
ttcaaatactacgcagcctgcaccttcctggtttttctgtccaacttcacaatccaaatg
ctggtgacaaccaggcccccagctctggccaccacctacagcatcaccttccttctcttc
cttctcctcctcttcgtctgcttctcagagcacctgacgaagtgcgtccagaaaggcccc
aagatgttgcactggctgcctgcgctgtctgtcctggtggccacacggccgggattgcga
gtagccctgggcacagccaccatcctcctggtgttcactatggccgtcgtcagcctgctc
ttcttaccagtgtcgtcagactgccctttcctggctcccaatgtgtcgtcagtggctttt
aatacttcctgggagctgccagcatccctgcctctcatcagcatcccatactccatgcat
tgttgcgtgctgggtttcctttcctgctccctttttctgcacatgagcttcgaactgaag
ctgcttctgcttctgctgtggctggtggcatcttgttccctatttctgcactcccacgcc
tggctgtccgactgcctcattgcccgcctttatcaaggctcattgggctccaggccgggg
gtactgaaggaaccgaaactgatgggagctatctacttcttcatcttcttcttcacactc
ctcgtcctggctcggcagaatgagtattactgtcgcctggacttcctatggaaaaagaaa
ctgaggcaggagcgagaggaaactgagacaatggagaacctgacccggctcctcctggag
aatgtactccctgcacacgtggcgccccagttcatcggccagaaccggcgcaatgaggac
ctctaccatcagtcgtacgaatgtgtttgtgtcctctttgcatccatcccagactttaag
gaattctactcggaatccaacatcaaccatgaggggctagagtgtctgcggctgctcaat
gagatcattgccgactttgatgagctgctctccaagccaaagttcagtggagtagagaag
atcaaaactatcggcagcacctacatggcggccacaggcctaaatgccacccctgggcag
gacacacaacaggacgctgagagaagctgcagccatctgggcaccatggtggaatttgca
gtggccctggggtctaagctgggtgtcatcaataagcactcgttcaacaacttccgcctg
cgtgtggggttaaaccatggaccagtcgtagcaggggtgattggggcgcagaagccacaa
tatgacatctgggggaatacagtgaacgtggccagccgcatggagagcacaggagttctc
ggcaagatccaagtgaccgaggagacagctagggctctgcaatccctgggttacacatgc
tacagccgaggtgtcatcaaggtcaagggcaaagggcaactctgtacctacttcctgaac
acagacctgacacgaaccggatctccctcagcatcctag

KEGG   Rattus norvegicus (rat): 64508
Entry
64508             CDS       T01003                                 

Gene name
Adcy3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno01522  Endocrine resistance
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04114  Oocyte meiosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04727  GABAergic synapse
rno04740  Olfactory transduction
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04921  Oxytocin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04962  Vasopressin-regulated water reabsorption
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04976  Bile secretion
rno05032  Morphine addiction
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    64508 (Adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    64508 (Adcy3)
   04371 Apelin signaling pathway
    64508 (Adcy3)
   04020 Calcium signaling pathway
    64508 (Adcy3)
   04072 Phospholipase D signaling pathway
    64508 (Adcy3)
   04024 cAMP signaling pathway
    64508 (Adcy3)
   04022 cGMP-PKG signaling pathway
    64508 (Adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    64508 (Adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    64508 (Adcy3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    64508 (Adcy3)
   04062 Chemokine signaling pathway
    64508 (Adcy3)
  09152 Endocrine system
   04911 Insulin secretion
    64508 (Adcy3)
   04923 Regulation of lipolysis in adipocytes
    64508 (Adcy3)
   04912 GnRH signaling pathway
    64508 (Adcy3)
   04913 Ovarian steroidogenesis
    64508 (Adcy3)
   04915 Estrogen signaling pathway
    64508 (Adcy3)
   04914 Progesterone-mediated oocyte maturation
    64508 (Adcy3)
   04921 Oxytocin signaling pathway
    64508 (Adcy3)
   04926 Relaxin signaling pathway
    64508 (Adcy3)
   04935 Growth hormone synthesis, secretion and action
    64508 (Adcy3)
   04918 Thyroid hormone synthesis
    64508 (Adcy3)
   04928 Parathyroid hormone synthesis, secretion and action
    64508 (Adcy3)
   04916 Melanogenesis
    64508 (Adcy3)
   04925 Aldosterone synthesis and secretion
    64508 (Adcy3)
   04927 Cortisol synthesis and secretion
    64508 (Adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    64508 (Adcy3)
   04270 Vascular smooth muscle contraction
    64508 (Adcy3)
  09154 Digestive system
   04970 Salivary secretion
    64508 (Adcy3)
   04971 Gastric acid secretion
    64508 (Adcy3)
   04972 Pancreatic secretion
    64508 (Adcy3)
   04976 Bile secretion
    64508 (Adcy3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    64508 (Adcy3)
  09156 Nervous system
   04724 Glutamatergic synapse
    64508 (Adcy3)
   04727 GABAergic synapse
    64508 (Adcy3)
   04725 Cholinergic synapse
    64508 (Adcy3)
   04723 Retrograde endocannabinoid signaling
    64508 (Adcy3)
  09157 Sensory system
   04740 Olfactory transduction
    64508 (Adcy3)
   04750 Inflammatory mediator regulation of TRP channels
    64508 (Adcy3)
  09149 Aging
   04211 Longevity regulating pathway
    64508 (Adcy3)
   04213 Longevity regulating pathway - multiple species
    64508 (Adcy3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    64508 (Adcy3)
   04714 Thermogenesis
    64508 (Adcy3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64508 (Adcy3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    64508 (Adcy3)
   05163 Human cytomegalovirus infection
    64508 (Adcy3)
  09165 Substance dependence
   05032 Morphine addiction
    64508 (Adcy3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    64508 (Adcy3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    64508 (Adcy3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    64508 (Adcy3)
Enzymes [BR:rno01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     64508 (Adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 64508
NCBI-ProteinID: NP_570135
RGD: 71009
Ensembl: ENSRNOG00000003999
UniProt: P21932 G3V6I2
Position
6
AA seq 1144 aa
MPRNQGFSDPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLMVAGVGLVLDII
LFVLCKKGLLPDRVSRKVVPYLLWLLITAQIFSYLGLNFSRAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDELEGMQLLREILANVFLYLCAIIVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLDEKGIETYLIIASKPEVKKTAQNGLNGSALPNGAPASKPSSPALIETKEPNGSAHASG
STSEEAEEQEAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESAQV
VKKRNTFLLTMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLFCTAMVEILIDPWLMTNYV
TFVVGEVLLLILTICSMAAIFPRAFPKKLVAFSSWIDRTRWARNTWAMLAIFILVMANVV
DMLSCLQYYMGPYNVTTGIELDGGCMENPKYYNYVAVLSLIATIMLVQVSHMVKLTLMLL
VTGAVTAINLYAWCPVFDEYDHKRFQEKDSPMVALEKMQVLSTPGLNGTDSRLPLVPSKY
SMTVMMFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHV
ARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFD
SLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSSKEEKSDKERWQHLADLADFA
LAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVM
GNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDRPAAFPNGSSVTLPHQV
VDNP
NT seq 3435 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctcggatcccgagtactcggcagagtactcagccgagtac
tcagtcagcttgccctctgaccccgaccgcggggtcggccggacccatgaaatttctgtg
cggaactctgggtcctgcctgtgcctgcctcgctttatgcggctgaccttcgtgcctgag
tccttggagaacctctaccagacctactttaaaaggcagcgccatgagacactgctggtg
ctggtggtctttgcggccctctttgactgctacgtggtagtgatgtgcgcggtggtcttt
tccagcgacaagctggcgcccctcatggtggcaggcgtcggtctggtgttggacatcatc
cttttcgtgctctgcaaaaaggggctgctcccggatcgagtgagccgcaaagtggtaccc
tacctgctgtggctgctcatcacagcccagatcttctcctacctgggcctgaacttttcg
cgtgcccacgcagccagtgacactgtgggttggcaggccttctttgtcttctccttcttc
ataacgctgccactcagcctcagccccatcgtgatcatctccgtggtctcctgtgttgtg
catacgcttgtcttgggggtcacggtggcccagcagcagcaagacgagctagaagggatg
cagctgctgagggagatcctggctaacgtcttcctctacctgtgcgccatcatcgtgggc
atcatgtcctactacatggcagaccgtaagcaccgaaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaatctggaggagcagagccagcagcaggaaaaccttatgctt
tccatcctgccaaagcatgtggctgacgagatgttgaaggacatgaagaaagatgagagt
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccatgagaatgtcagcatc
ctgtttgcagatattgtgggctttacccagctgtcctctgcttgcagtgcccaggagctc
gtgaagctactcaacgagctctttgcccgctttgacaagctggcggccaaataccaccag
ctgaggatcaagatcctaggcgactgttactactgcatctgcggcctgcctgactaccgg
gaggaccacgccgtgtgctccatcctgatggggcttgccatggtagaggccatctcgtac
gtgcgggagaagaccaagaccggagtggacatgcgtgtgggggtgcacacaggcactgtg
ctaggtggcgtcctgggccagaagcgctggcagtatgatgtatggtctaccgatgtcact
gtggcaaacaagatggaggctggcggcatcccagggcgcgtgcacatttcccagagcacc
atggactgcctgaaaggggagttcgatgtcgaacctggtgatggtggcagtcgctgcgac
tacctagatgagaagggcatcgaaacctacctcatcattgcctccaagccagaggtgaag
aagacagctcaaaatggcctcaacggctcggccctgccaaacggagcaccggcatccaag
cccagctcccctgcccttattgagaccaaggagcccaatgggagtgcccatgccagcggc
tccacatcagaggaggctgaagaacaggaggcccaggctgacaacccctcgttccccaac
ccccgccgcaggctgcgcctccaggacctggcagaccgtgtggtggacgcctctgaggat
gagcacgaactgaaccagcttcttaacgaggccctgctggagcgggagtccgcccaggtg
gtaaagaagagaaacacattcctcctaacgatgaggttcatggacccagagatggaaaca
cgctactcggtggagaaggagaagcagagtggggctgccttcagctgttcctgtgtggtc
cttttctgcacggccatggtggagatacttatcgacccctggttgatgacaaactacgtg
accttcgtggttggagaggttctgctcttgatcctgaccatctgttcgatggctgccatc
ttccccagggcatttcctaagaagctcgtggccttctcatcttggattgaccggacccgc
tgggccagaaatacctgggccatgttagccatcttcattctggttatggccaatgttgtg
gacatgctgagctgtctccagtactacatgggaccttacaacgtgacaaccgggatagag
ctggacggtggctgtatggagaaccccaagtactacaactatgttgctgtgctgtccctc
atcgccaccatcatgctggtgcaggtcagccacatggtgaagctgacactcatgctgctc
gtcacaggcgccgtgactgccatcaacctgtatgcctggtgtcctgtctttgatgaatac
gaccacaaacgctttcaggaaaaggactctcctatggtggccttagagaagatgcaggta
ctttccacccctgggctcaatggcactgacagcaggctgcccctggtgccttccaagtac
tcgatgactgtgatgatgttcgttatgatgctgagcttttactacttctcacgccacgtg
gagaaactggcccggacactgttcttgtggaagattgaggtccatgaccagaaagaacgt
gtgtacgagatgcgccggtggaacgaggccttggtcaccaacatgttgccagagcatgtt
gcacgccatttcctgggctccaagaagagagatgaggagctgtacagccagtcttatgac
gagattggagtcatgtttgcctccttgcccaactttgccgacttctacactgaggagagc
atcaataatggtggcatcgagtgtctacgcttcctcaatgagatcatctctgattttgac
tctctcctggacaatcccaaattccgggtcatcaccaagatcaaaaccatcggcagcacc
tatatggcagcttctggagtcacaccagatgtcaacaccaatggctttacaagctccagc
aaggaggaaaagtcagacaaggagcgctggcagcacctggctgacctggcagactttgca
ctagccatgaaggacacgcttacaaacatcaacaaccagtcattcaacaacttcatgctg
cgcataggcatgaacaaaggaggagttctggctggagtcattggagcccggaagccacac
tatgacatctgggggaacacggtcaatgtggccagcaggatggaatccacaggggtcatg
ggcaatatccaggtggtagaagagacacaggtcatccttcgagagtatggcttccgcttt
gtgaggcgaggacccatctttgtgaagggcaaaggggagcttctgacctttttcttaaag
gggcgggacaggccagctgccttccccaatggctcctctgttacactgccccaccaagtg
gtggacaacccctga

KEGG   Rattus norvegicus (rat): 64532
Entry
64532             CDS       T01003                                 

Gene name
Adcy5
Definition
(RefSeq) adenylate cyclase type 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno01522  Endocrine resistance
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04114  Oocyte meiosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04921  Oxytocin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04976  Bile secretion
rno05012  Parkinson disease
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05032  Morphine addiction
rno05034  Alcoholism
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    64532 (Adcy5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    64532 (Adcy5)
   04371 Apelin signaling pathway
    64532 (Adcy5)
   04072 Phospholipase D signaling pathway
    64532 (Adcy5)
   04024 cAMP signaling pathway
    64532 (Adcy5)
   04022 cGMP-PKG signaling pathway
    64532 (Adcy5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    64532 (Adcy5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    64532 (Adcy5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    64532 (Adcy5)
   04062 Chemokine signaling pathway
    64532 (Adcy5)
  09152 Endocrine system
   04911 Insulin secretion
    64532 (Adcy5)
   04923 Regulation of lipolysis in adipocytes
    64532 (Adcy5)
   04912 GnRH signaling pathway
    64532 (Adcy5)
   04913 Ovarian steroidogenesis
    64532 (Adcy5)
   04915 Estrogen signaling pathway
    64532 (Adcy5)
   04914 Progesterone-mediated oocyte maturation
    64532 (Adcy5)
   04921 Oxytocin signaling pathway
    64532 (Adcy5)
   04926 Relaxin signaling pathway
    64532 (Adcy5)
   04935 Growth hormone synthesis, secretion and action
    64532 (Adcy5)
   04918 Thyroid hormone synthesis
    64532 (Adcy5)
   04928 Parathyroid hormone synthesis, secretion and action
    64532 (Adcy5)
   04916 Melanogenesis
    64532 (Adcy5)
   04924 Renin secretion
    64532 (Adcy5)
   04925 Aldosterone synthesis and secretion
    64532 (Adcy5)
   04927 Cortisol synthesis and secretion
    64532 (Adcy5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    64532 (Adcy5)
   04270 Vascular smooth muscle contraction
    64532 (Adcy5)
  09154 Digestive system
   04970 Salivary secretion
    64532 (Adcy5)
   04971 Gastric acid secretion
    64532 (Adcy5)
   04972 Pancreatic secretion
    64532 (Adcy5)
   04976 Bile secretion
    64532 (Adcy5)
  09156 Nervous system
   04724 Glutamatergic synapse
    64532 (Adcy5)
   04727 GABAergic synapse
    64532 (Adcy5)
   04725 Cholinergic synapse
    64532 (Adcy5)
   04728 Dopaminergic synapse
    64532 (Adcy5)
   04726 Serotonergic synapse
    64532 (Adcy5)
   04723 Retrograde endocannabinoid signaling
    64532 (Adcy5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    64532 (Adcy5)
  09149 Aging
   04211 Longevity regulating pathway
    64532 (Adcy5)
   04213 Longevity regulating pathway - multiple species
    64532 (Adcy5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    64532 (Adcy5)
   04714 Thermogenesis
    64532 (Adcy5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64532 (Adcy5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    64532 (Adcy5)
   05163 Human cytomegalovirus infection
    64532 (Adcy5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    64532 (Adcy5)
  09165 Substance dependence
   05030 Cocaine addiction
    64532 (Adcy5)
   05031 Amphetamine addiction
    64532 (Adcy5)
   05032 Morphine addiction
    64532 (Adcy5)
   05034 Alcoholism
    64532 (Adcy5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    64532 (Adcy5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    64532 (Adcy5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    64532 (Adcy5)
Enzymes [BR:rno01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     64532 (Adcy5)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD GBR2_CC
Other DBs
NCBI-GeneID: 64532
NCBI-ProteinID: NP_072122
RGD: 71014
Ensembl: ENSRNOG00000002229
UniProt: Q04400
Position
11
AA seq 1262 aa
MSGSKSVSPPGYAAQTAASPAPGGGPEHRAAWGEADSRANGYPHAPGGSTRGSTKRSGGA
VTPQQQQRLASRWRGGDDDEDPPLSGDDPLVGGFGFSFRSKSAWQERGGDDGGRGSRRQR
RGAAGGGSTRAPPAGGSGSSAAAAAAAGGTEVRPRSVEVGLEERRGKGRAAEELEPGTGT
VEDGDGSEDGGSSVASGSGTGTVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLNQ
SSLTMLMAVLVLVCLVMLAFHAARPPLQVVYLAVLAAAVGVILIMAVLCNRAAFHQDHMG
LACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSA
LHLAISLHTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARL
HSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFT
SLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVE
MGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGG
KAGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKM
NRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEF
LGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQ
ITIVPHSLFMLSFYLSCFLLLALVVFISVIYACVKLFPTPLQTLSRKIVRSKKNSTLVGV
FTITLVFLSAFVNMFMCNSKNLVGCLAEEHNITVNQVNACHVMESAFNYSLGDEQGFCGS
PQSNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLIVEVPGVTLFDNAD
LLVTANAIDFSNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWK
LQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIAN
FSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDST
YDKAGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIW
GNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPP
LS
NT seq 3789 nt   +upstreamnt  +downstreamnt
atgtccggctccaaaagcgtgagccccccgggctacgctgcacagacagcagcgtcgccc
gcgcccgggggaggcccggagcatcgcgccgcgtggggagaagccgattcccgcgccaat
ggctacccccacgcccccgggggatcgacccgcggctccaccaagcgatctgggggagcg
gtgaccccacaacagcagcagcgcctggctagccgttggcgcggtggcgacgacgatgaa
gaccctccactaagcggtgacgaccctctggtcggaggcttcggcttcagcttccgttct
aagtcggcctggcaggagcgcggcggcgacgacggcggtcgcggcagcaggcggcagcgg
cggggcgcggctggagggggcagcacccgggcgccccctgcgggcggcagtggcagttcg
gcggcggccgcagcagccgcaggtggcacggaggtgcgcccccgctcggtggaggtgggc
ctggaggagcgtcgaggaaaaggccgagcggccgaggagctggagcccggaactggcacc
gtcgaggatggagacgggtccgaggatggaggcagttccgtggcgtcaggctctgggacc
ggcacggtgctgtcgttgggcgcctgctgcctggccttgctgcagatattccgctctaag
aagttcccgtcggacaaactggagcgtctgtaccagcgctatttcttccgcctgaaccag
agcagcctcaccatgctcatggccgtgctggtgctcgtgtgcctggtcatgctcgctttc
cacgcggcacggcccccgctccaggtagtctacctggccgtgttggcagctgctgtgggc
gtgatccttatcatggctgtgctctgcaaccgtgcagccttccaccaggaccacatgggc
ctggcctgctatgcgctcattgcagtggtgctggccgtccaggtagtgggcctgttgctg
ccacagccacgcagcgcctccgagggcatctggtggaccgtgttcttcatctataccatc
tacaccctgctgcctgtgcgcatgagggctgcggtgctcagcggggtgcttctgtcggct
ctccacttggccatctctctgcacaccaacgcccaggaccagtttctgctgaaacagctt
gtctccaacgtcctcatcttctcttgcaccaacatcgtgggtgtgtgcactcactaccca
gccgaggtctcccagagacaggccttccaggagacccgggagtgcatccaagctcggctc
cactcacagcgggagaaccagcaacaggagcgtctcctgctgtctgtccttccccgtcat
gttgccatggagatgaaagcagacatcaacgccaaacaggaggatatgatgttccacaag
atttacatccagaaacatgacaatgtgagcatcctgtttgctgacatcgaaggcttcact
agcctggcatcccagtgtactgcccaagaactggtcatgaccctcaacgagctcttcgcc
cgctttgacaagttggctgcggagaatcactgcttacggattaagatcctcggggattgt
tactactgtgtctcggggctgcctgaagccagagctgaccacgcccactgctgcgtagag
atgggaatggacatgatcgaggccatctcgttggtccgggaggtgacaggggtgaacgtg
aacatgcgtgtgggaattcacagcgggagagtacactgcggtgtccttggcctcagaaag
tggcaattcgacgtgtggtctaacgatgtcacactggccaaccacatggaagctggcggc
aaggcaggccgcatccacatcaccaaggccacactcaactacctgaacggggactatgag
gtggagccaggctgtggtggtgagcgcaatgcctacctcaaggagcacagcatcgagacc
ttcctcatcctgcgctgtacccagaagcggaaagaagagaaggccatgatcgccaagatg
aaccgccagagaaccaactccattggacacaatccgcctcactggggagctgagcgcccc
ttctacaaccacttgggtggcaaccaggtgtccaaggagatgaagaggatgggctttgag
gaccccaaggacaagaatgcccaggaaagtgccaaccctgaggatgaagtggacgagttt
ctgggtcgagccatcgatgccaggagtattgacagactgcgatccgaacacgtccgaaag
ttcctcttgacctttagggagcccgacttagagaagaagtactccaagcaggtggatgac
cgatttggtgcctatgtggcctgtgcctcgcttgttttcctcttcatctgctttgtccag
atcaccattgtgccccactccctgttcatgctgagcttctacctgtcgtgtttcctgcta
ctggccttggtggtgtttatatctgtgatctacgcctgtgtgaagctcttccctactccc
ctgcagacactctccaggaagatagtgcgatccaagaagaacagcaccctggtcggggtg
ttcaccatcaccctggtgttcctctcggcttttgtcaacatgttcatgtgcaactctaag
aacctggtgggttgcctggcagaggagcacaacatcacggtgaaccaggtgaacgcatgt
catgtgatggagtcggccttcaactacagcctgggcgacgagcagggcttctgtggcagc
ccccagtccaactgcaacttcccagagtacttcacctacagcgtgctgctcagcctgctg
gcctgctccgtgttcctgcagatcagctgcatcgggaagctggtgctcatgctggccatc
gagctcatctacgtgctcatcgtagaggtgcccggtgtcacactctttgacaacgctgac
cttctggtcaccgccaatgccatagacttcagcaacaacgggacctcccagtgccctgag
catgcgaccaaggtggcgctgaaggtggtgacgcccatcatcatctctgtcttcgtgctg
gctctgtatctgcatgctcagcaggtggaatccactgctcgccttgacttcctctggaaa
ctgcaggccacagaagagaaggaggagatggaggagctgcaggcctacaaccggcgcttg
ctgcacaacattctgcccaaggacgtggctgcccacttcctggcccgggagcggcgcaat
gatgaactgtactaccaatcctgcgagtgcgtggctgtcatgtttgcctccatcgccaac
ttctccgaattctacgtggagctagaggccaacaatgagggcgttgaatgcctacggctg
ctcaatgagatcatcgcagactttgatgagatcatcagtgaggatcggttcaggcagctg
gaaaagatcaagaccataggtagcacctacatggctgcctctggcctcaacgactccacc
tatgacaaggcaggcaagacccacatcaaggctcttgcagacttcgccatgaagctgatg
gaccaaatgaagtacatcaatgagcactccttcaacaacttccagatgaagatcgggctt
aacattggacctgtagtggctggggtcattggggctcgcaagcctcagtatgacatctgg
ggcaatacagtaaatgtggccagccgtatggacagcactggggtgcctgaccgcatccag
gttactacagatatgtaccaggtgctggccgccaacacataccagctggagtgccggggt
gtggtcaaggtcaagggcaagggtgagatgatgacctacttcctcaatggagggcctccc
ctcagttag

KEGG   Rattus norvegicus (rat): 81636
Entry
81636             CDS       T01003                                 

Gene name
Adcy2
Definition
(RefSeq) adenylate cyclase type 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno01522  Endocrine resistance
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04114  Oocyte meiosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04727  GABAergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04976  Bile secretion
rno05032  Morphine addiction
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    81636 (Adcy2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    81636 (Adcy2)
   04371 Apelin signaling pathway
    81636 (Adcy2)
   04020 Calcium signaling pathway
    81636 (Adcy2)
   04072 Phospholipase D signaling pathway
    81636 (Adcy2)
   04024 cAMP signaling pathway
    81636 (Adcy2)
   04022 cGMP-PKG signaling pathway
    81636 (Adcy2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    81636 (Adcy2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    81636 (Adcy2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    81636 (Adcy2)
   04062 Chemokine signaling pathway
    81636 (Adcy2)
  09152 Endocrine system
   04911 Insulin secretion
    81636 (Adcy2)
   04922 Glucagon signaling pathway
    81636 (Adcy2)
   04923 Regulation of lipolysis in adipocytes
    81636 (Adcy2)
   04912 GnRH signaling pathway
    81636 (Adcy2)
   04913 Ovarian steroidogenesis
    81636 (Adcy2)
   04915 Estrogen signaling pathway
    81636 (Adcy2)
   04914 Progesterone-mediated oocyte maturation
    81636 (Adcy2)
   04921 Oxytocin signaling pathway
    81636 (Adcy2)
   04926 Relaxin signaling pathway
    81636 (Adcy2)
   04935 Growth hormone synthesis, secretion and action
    81636 (Adcy2)
   04918 Thyroid hormone synthesis
    81636 (Adcy2)
   04928 Parathyroid hormone synthesis, secretion and action
    81636 (Adcy2)
   04916 Melanogenesis
    81636 (Adcy2)
   04925 Aldosterone synthesis and secretion
    81636 (Adcy2)
   04927 Cortisol synthesis and secretion
    81636 (Adcy2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    81636 (Adcy2)
   04270 Vascular smooth muscle contraction
    81636 (Adcy2)
  09154 Digestive system
   04970 Salivary secretion
    81636 (Adcy2)
   04971 Gastric acid secretion
    81636 (Adcy2)
   04972 Pancreatic secretion
    81636 (Adcy2)
   04976 Bile secretion
    81636 (Adcy2)
  09156 Nervous system
   04724 Glutamatergic synapse
    81636 (Adcy2)
   04727 GABAergic synapse
    81636 (Adcy2)
   04725 Cholinergic synapse
    81636 (Adcy2)
   04723 Retrograde endocannabinoid signaling
    81636 (Adcy2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    81636 (Adcy2)
  09149 Aging
   04211 Longevity regulating pathway
    81636 (Adcy2)
   04213 Longevity regulating pathway - multiple species
    81636 (Adcy2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    81636 (Adcy2)
   04714 Thermogenesis
    81636 (Adcy2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81636 (Adcy2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    81636 (Adcy2)
   05163 Human cytomegalovirus infection
    81636 (Adcy2)
  09165 Substance dependence
   05032 Morphine addiction
    81636 (Adcy2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    81636 (Adcy2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    81636 (Adcy2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    81636 (Adcy2)
Enzymes [BR:rno01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     81636 (Adcy2)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA DUF349
Other DBs
NCBI-GeneID: 81636
NCBI-ProteinID: NP_112269
RGD: 619965
Ensembl: ENSRNOG00000032150
UniProt: P26769
Structure
PDB: 

Position
1
AA seq 1090 aa
MRRRRYLRDRAEAAAAAAAGGGEGLQRSRDWLYESYYCMSQQHPLIVFLLLIVMGACLAL
LAVFFALGLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRVFSLVIWICLVAMG
YLFMCFGGTVSAWDQVSFFLFIIFVVYTMLPFNMRDAIIASILTSSSHTIVLSVYLSATP
GAKEHLFWQILANVIIFICGNLAGAYHKHLMELALQQTYRDTCNCIKSRIKLEFEKRQQE
RLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGFTR
LASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVKM
GLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGV
PGRVHISSVTLEHLNGAYKVEEGDGEIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPRH
TLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTLR
TKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKNIEKEYRATALPAFK
YYVTCACLIFLCIFIVQILVLPKTSILGFSFGAAFLSLIFILFVCFAGQLLQCSKKASTS
LMWLLKSSGIIANRPWPRISLTIVTTAIILTMAVFNMFFLSNSEETTLPTANTSNANVSV
PDNQASILHARNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNTILLHTH
AHVLDAYSQVLFQRPGIWKDLKTMGSVSLSIFFITLLVLGRQSEYYCRLDFLWKNKFKKE
REEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEFYT
ESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAIPSQEHAQ
EPERQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIW
GNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNTEMS
RSLSQSNLAS
NT seq 3273 nt   +upstreamnt  +downstreamnt
atgcggcggcgccgctacctgcgggaccgcgccgaggcggcggcggcagcggcggcggga
ggcggagaggggctgcagcggtcccgggactggctctacgagtcctactactgcatgagc
cagcagcacccgctcatcgtcttcctgctgctcatcgtcatgggcgcctgcctcgccctg
ctagccgtcttcttcgcgctcgggctggaggtggaagaccatgtggcatttttaataacg
gttcccactgccctggccattttctttgccatattcattcttgtctgcatagagtctgtg
ttcaagaagctactccgtgtgttttcgctggtgatttggatatgtctggttgccatggga
tacctgttcatgtgcttcggagggactgtgtctgcctgggaccaggtgtcattcttcctc
ttcatcatctttgtggtatataccatgcttcccttcaacatgcgagatgccatcattgcc
agcatcctcacatcttcatctcatacgatagtgctgagcgtctacctgtctgcaacacca
ggggccaaggagcacctgttctggcagatactggccaatgtgatcattttcatttgtggg
aacttggcgggagcctaccacaagcacctcatggagcttgccttgcagcaaacctatcgg
gacacgtgtaattgcatcaagtcccggatcaagctggaatttgaaaaacggcagcaggaa
cggctcctgctctccttgctgccagctcacatcgccatggagatgaaagctgaaatcatt
cagaggctgcagggccccaaagcaggacagatggaaaacacaaacaacttccacaatctg
tatgtcaaacgacacaccaacgtgagcatattatacgctgacattgttggcttcacccgc
cttgcaagcgattgctcccctggcgaactggtccacatgctgaatgaactctttgggaag
tttgatcaaatagcaaaggagaatgaatgcatgagaattaaaattttaggagactgctat
tactgtgtttccgggctccctatatcactccctaaccatgccaagaactgtgtgaaaatg
ggattggatatgtgcgaagccataaagaaagtgagggatgctaccggagttgatatcaac
atgcgtgtaggagtgcattctgggaacgttctctgtggtgtgattggtctccagaagtgg
cagtatgatgtgtggtctcatgatgttactctggcaaaccacatggaagctggaggagtc
cctgggcgtgttcacatttcttcagtcactctggagcacttgaatggggcttataaagtg
gaggaaggagatggtgagataagagacccatatttaaagcagcacttggtgaaaacctac
tttgtaatcaatcccaagggagagcgacggagtcctcagcatctcttcagacctcgacac
actctggacggagccaagatgagagcatctgtccgcatgacccggtacttggagtcctgg
ggagcagccaagccattcgcacatctgcaccacagagatagcatgaccacagagaatggg
aagattagtaccacggatgtgccaatgggtcaacataattttcaaaatcgcaccttaaga
actaagtcacagaagaagagatttgaagaagaactgaatgaaaggatgatccaagcaatt
gatgggatcaatgcacagaagcaatggctcaagtcagaagacattcaaagaatctccctg
cttttctataacaagaatatagagaaagaataccgagctactgcactgccagcattcaag
tactacgtgacctgtgcctgcctcatctttctctgcatcttcattgtacagatacttgta
ttgccaaaaacgtccatccttggcttctcctttggagctgcatttctctccctcatcttc
atcctctttgtctgcttcgctggacagcttttgcaatgcagcaaaaaggcctccacctct
ctcatgtggcttttgaaatcatcaggcatcatcgccaaccgcccatggccacggatctcc
ctcacaatcgtcaccacggctatcatactaaccatggctgtgttcaacatgtttttcctg
agcaactctgaggagacaacccttcccactgccaatacatcaaatgcaaacgtttctgtc
ccggataaccaggcgtcgattcttcatgctcgaaacttgtttttcctcccgtacttcata
tacagctgcatcctgggcttgatctcctgctccgttttcctgagggtgaactatgagtta
aaaatgttaatcatgatggtggcactcgtgggctacaacaccattctactccacacccat
gcccatgttctggatgcgtacagccaggtcctgtttcagagaccaggcatttggaaagac
ctgaagaccatgggctccgtgtcactctccatattcttcatcacgctgctggttctgggc
agacagagtgaatattactgtaggttagacttcttgtggaagaacaagttcaaaaaagag
cgggaggagatagaaaccatggagaacctaaatcgagtgctgctggagaacgtgcttcct
gcacacgtggctgaacacttcctggccaggagcctgaaaaatgaggagctgtaccaccag
tcctacgactgtgtctgtgtcatgtttgcctccattccggacttcaaggagttctacaca
gagtcagatgtgaacaaggaaggcttggaatgcctgcggctcctgaatgagatcattgct
gactttgatgatctgctttctaagccaaagttcagtggtgttgaaaagatcaagaccatt
gggagcacatacatggcagccacgggactgagtgccatacccagccaggagcacgcccag
gaacctgagcgtcagtacatgcacataggcaccatggtggagtttgcatatgccctggtg
ggaaaactggatgccatcaataagcactccttcaacgacttcaaactgcgagtgggtatc
aaccatgggcctgtaatagctggcgtcataggggctcaaaagccacagtatgacatctgg
ggcaacactgtcaacgtggccagcagaatggacagcaccggggtcctggacaaaatacag
gtgactgaggagacaagcctcatcttgcagacgcttggctacacgtgtacatgtcgaggt
atcatcaatgtgaaggggaaaggggacctgaagacatattttgtaaacacagagatgtca
aggtccctttctcagagcaacttggcatcctga

KEGG   Rattus norvegicus (rat): 84420
Entry
84420             CDS       T01003                                 

Gene name
Adcy7
Definition
(RefSeq) adenylate cyclase type 7
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno01522  Endocrine resistance
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04114  Oocyte meiosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04727  GABAergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04921  Oxytocin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04976  Bile secretion
rno05032  Morphine addiction
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    84420 (Adcy7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    84420 (Adcy7)
   04371 Apelin signaling pathway
    84420 (Adcy7)
   04020 Calcium signaling pathway
    84420 (Adcy7)
   04072 Phospholipase D signaling pathway
    84420 (Adcy7)
   04024 cAMP signaling pathway
    84420 (Adcy7)
   04022 cGMP-PKG signaling pathway
    84420 (Adcy7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    84420 (Adcy7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    84420 (Adcy7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    84420 (Adcy7)
   04062 Chemokine signaling pathway
    84420 (Adcy7)
  09152 Endocrine system
   04911 Insulin secretion
    84420 (Adcy7)
   04923 Regulation of lipolysis in adipocytes
    84420 (Adcy7)
   04912 GnRH signaling pathway
    84420 (Adcy7)
   04913 Ovarian steroidogenesis
    84420 (Adcy7)
   04915 Estrogen signaling pathway
    84420 (Adcy7)
   04914 Progesterone-mediated oocyte maturation
    84420 (Adcy7)
   04921 Oxytocin signaling pathway
    84420 (Adcy7)
   04926 Relaxin signaling pathway
    84420 (Adcy7)
   04935 Growth hormone synthesis, secretion and action
    84420 (Adcy7)
   04918 Thyroid hormone synthesis
    84420 (Adcy7)
   04928 Parathyroid hormone synthesis, secretion and action
    84420 (Adcy7)
   04916 Melanogenesis
    84420 (Adcy7)
   04925 Aldosterone synthesis and secretion
    84420 (Adcy7)
   04927 Cortisol synthesis and secretion
    84420 (Adcy7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    84420 (Adcy7)
   04270 Vascular smooth muscle contraction
    84420 (Adcy7)
  09154 Digestive system
   04970 Salivary secretion
    84420 (Adcy7)
   04971 Gastric acid secretion
    84420 (Adcy7)
   04972 Pancreatic secretion
    84420 (Adcy7)
   04976 Bile secretion
    84420 (Adcy7)
  09156 Nervous system
   04724 Glutamatergic synapse
    84420 (Adcy7)
   04727 GABAergic synapse
    84420 (Adcy7)
   04725 Cholinergic synapse
    84420 (Adcy7)
   04723 Retrograde endocannabinoid signaling
    84420 (Adcy7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    84420 (Adcy7)
  09149 Aging
   04211 Longevity regulating pathway
    84420 (Adcy7)
   04213 Longevity regulating pathway - multiple species
    84420 (Adcy7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    84420 (Adcy7)
   04714 Thermogenesis
    84420 (Adcy7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    84420 (Adcy7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    84420 (Adcy7)
   05163 Human cytomegalovirus infection
    84420 (Adcy7)
  09165 Substance dependence
   05032 Morphine addiction
    84420 (Adcy7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    84420 (Adcy7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    84420 (Adcy7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    84420 (Adcy7)
Enzymes [BR:rno01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     84420 (Adcy7)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 84420
NCBI-ProteinID: NP_445848
RGD: 619966
Ensembl: ENSRNOG00000014776
UniProt: F1LQT1
Position
19
AA seq 1100 aa
MPAKGRYFLNEGDEGPKQAALYEKYRLTSQHGPLLLLLLLVAVATCIALVSIVFSHEDLR
RHQAVLGTAFFMLTLFVALYVLVYVECLAQRWLRVLALLTWACLMILGSVLMWDSLENEA
YAWEQVPFFLFIVFVVYVLLPLSTRAAIAVGVASTISHLLVFGAVTRAFKTSMSSTQLGL
QLLANAVILLGGNFTGAFHKHQLQDASRDLFIYTVKCIQIRRKLRVEKRQQENLLLSVLP
AHISMGMKLAIIERLKEGGDRHYTPDNNFHSLYVKRHQNVSILYADIVGFTRLASDCSPK
ELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDICEAI
KQVREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITE
ATLNHLDKAYEVEDGHGEQRDPYLKEMNIRTYLVIDPRSQQPPLPSHHLSKPKGDATLKM
RASVRVTRYLESWGAARPFAHLNHRESVSSSEIPIPNGRRQKAIPLRRHRAPDRSASPKG
RLEDDCDDEMLSAIEGLSSTRPCCSKSDDFHTFGPIFLEKGFEREYRLVPIPRARYDFAC
ASLVFVCILLVHLLVMPRMATLGLSFGLVACLLGLVLSFCFATEFSRCLPARSTLQAISE
SVETQPLLRLSLVVVTVGSLLTVAIINMPLTFNPGPEQPGDNETSPLAARNRVGTPCELL
PYYTCSCVLGFIACSVFLRMSLELKAMLLTVALVAYLLLFNLSPCWQVSGNSTETNSTHR
TRRLLSAEQSMNSHTLALGAQMTAPSPSSCLERDLKTMINFYLVLFYATLILLSRQIDYY
CRLDCLWKKKFKKEHEEFETMENVNRLLLENVLPAHVAAHFIGDKAAEDWYHQSYDCVCV
MFASVPDFKVFYTECDVNKEGLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAA
AGLSVPSGHENQDLERKHVHIGVLVEFSMALMSKLDGINRHSFNSFRLRVGINHGPVIAG
VIGARKPQYDIWGNTVNVASRMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKG
ELRTYFVCTDTAKFQGLGLN
NT seq 3303 nt   +upstreamnt  +downstreamnt
atgccagccaaggggcgctacttcctaaatgagggtgacgaaggccccaagcaggcagcg
ctctatgagaagtacaggctcaccagccagcacgggccactgctgctcctgctcctcctg
gtggctgtggccacctgcatcgccctcgtcagcatcgtcttcagccatgaggatctccgc
agacaccaggctgtcctgggcactgcgttcttcatgctgacgctgtttgtggctctctat
gtgctggtgtatgttgagtgcctagcacagcgatggctgcgcgtcttggctctactcacc
tgggcttgcctcatgatactaggctccgtgctgatgtgggactccttggagaatgaagcc
tatgcgtgggagcaggtgcctttcttcctgttcatcgtctttgtggtgtacgtactgttg
cctctcagcacgagggcagctatcgcggtgggcgtagcctccaccatctcccatctcctg
gtgtttggagctgtgacaagagccttcaagacatccatgtccagcacacagctggggctg
cagctcctggccaatgccgttatccttctgggtgggaacttcaccggtgccttccacaag
caccagcttcaggacgcttcgagggatctcttcatctacaccgtcaagtgtatccagatc
cgccggaagcttcgcgtggagaagcgccagcaggagaacctgctgctttcagtgctccca
gctcacatctccatgggtatgaagctggccatcattgaacgcctcaaagagggtggtgac
cgccactacacgcctgacaacaactttcacagcctctatgtcaagcggcaccagaacgtc
agcatcttgtatgcagacatcgtgggtttcacgaggctggccagcgactgctctcccaag
gagctagtggtggtgctcaacgagctgtttgggaagtttgaccagattgccaaggccaac
gagtgcatgcggatcaagatcctgggtgactgctactactgcgtgtcaggcctgcctgtg
tcgctgcccacgcacgcccgcaactgtgtgaagatgggtctggacatatgtgaggccatt
aagcaggtgcgtgaggccaccggagtggacatcagcatgcgtgtgggcattcactctggg
aatgtcctgtgtggggtcatcgggctccgcaagtggcagtatgacgtgtggtcccatgac
gtgtccctggccaacaggatggaggcagctggagtccctggccgggtgcacatcacagag
gcgacactgaatcacctggacaaggcatacgaggtggaggacgggcacggggagcagcgc
gacccctatctgaaagagatgaacatccgtacctacttggtgattgacccccggagtcag
cagccgcccctacccagccaccacctgtccaagcccaagggggatgcaactctgaagatg
cgggcttccgtgcgtgtaacccgctatctggagtcctggggggcagcgcggccctttgca
cacctcaaccaccgggagagcgtgagcagcagtgagatccccatccccaacggacggagg
cagaaggccattcctctgcgtcgacaccgtgcccctgataggagtgcatcccccaaggga
cgcctggaagatgactgtgatgacgagatgctgtcagccattgaggggctcagctccacc
aggccctgctgctccaagtctgatgacttccacacctttggtcccatcttcctggagaag
ggctttgagcgtgagtaccgcctggtgcccatcccccgggctcgctatgacttcgcctgt
gccagccttgtcttcgtctgcatcctgcttgtccacctcctagtgatgcccaggatggca
actctgggcttgtcctttgggctggtggcctgcctgctggggctggttctaagcttctgc
tttgctactgagttctcgaggtgccttccagcccgaagtacactccaggccatctcggag
agtgtggagacacagcccctgctcagactttccctggttgtggtgactgttggcagctta
ctgactgttgccatcatcaacatgccactgacatttaacccaggcccagagcagcctgga
gacaatgagacaagcccactggctgcaaggaacagagttgggaccccatgtgaactcctc
ccgtactacacctgcagctgcgtcctgggcttcattgcatgctctgttttcctgcggatg
agcctggaactgaaggccatgttgctgacggtggccttggtggcctacctgctgctcttc
aacctctccccatgctggcaggtctcaggcaacagcacagagaccaacagcacacacagg
acacgtcggctcctgtctgcagaacaaagcatgaacagccacacccttgctctgggggct
cagatgactgccccctcccccagcagttgtttagagagagacctgaagaccatgatcaac
ttctacctggtcctgttctatgccaccctcatcttgctgtctagacagattgactattac
tgccgcttggactgtctgtggaagaagaagtttaagaaggagcatgaggagtttgaaaca
atggagaatgtgaaccgcctcctcctagagaatgttctgccagcacatgtggctgcccac
ttcatcggtgacaaggcagctgaggactggtaccatcaatcttatgactgtgtctgtgtc
atgtttgcatccgttccggacttcaaagtgttctatactgagtgtgatgtcaacaaagaa
ggattggagtgccttcgcctgctgaatgagatcattgctgattttgacgagctgctgctg
aagcccaagttcagtggtgtggagaagatcaagaccattggcagcacctacatggctgct
gcagggctcagtgtcccctcaggacatgagaaccaggacctggagcggaagcatgtgcac
attggtgtcttggtggagtttagcatggccctgatgagcaagctggatggaatcaacagg
cactccttcaactccttccgcctccgagttggcataaaccacggccctgtgattgctgga
gtgattggcgcacgcaagcctcagtatgacatctggggaaacacagtcaatgttgccagc
cgcatggagagcaccggagagcttgggaagatccaggttaccgaggagacgtgcaccatc
ctccagggactgggatattcttgtgagtgccgtgggctcatcaacgtcaaaggcaaaggg
gagctgcggacttactttgtttgtacagacactgccaagtttcaagggctggggctaaac
tga

DBGET integrated database retrieval system