KEGG   Rattus norvegicus (rat): 25290Help
Entry
25290             CDS       T01003                                 

Gene name
Alox5, LOX5A
Definition
(RefSeq) arachidonate 5-lipoxygenase
  KO
K00461  arachidonate 5-lipoxygenase [EC:1.13.11.34]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00590  Arachidonic acid metabolism
rno01100  Metabolic pathways
rno04664  Fc epsilon RI signaling pathway
rno04726  Serotonergic synapse
rno04913  Ovarian steroidogenesis
rno05145  Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    25290 (Alox5)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    25290 (Alox5)
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    25290 (Alox5)
  09156 Nervous system
   04726 Serotonergic synapse
    25290 (Alox5)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    25290 (Alox5)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.34  arachidonate 5-lipoxygenase
     25290 (Alox5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipoxygenase PLAT
Motif
Other DBs
NCBI-GeneID: 25290
NCBI-ProteinID: NP_036954
RGD: 2096
Ensembl: ENSRNOG00000012972
UniProt: P12527
Position
4q42
AA seq 670 aa AA seqDB search
MPSYTVTVATGSQWFAGTDDYIYLSLIGSAGCSEKHLLDKAFYNDFERGGRDSYDVTVDE
ELGEIYLVKIEKRKYRLHDDWYLKYITLKTPHDYIEFPCYRWITGEGEIVLRDGCAKLAR
DDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLN
YSKAMENLFINRFMHMFQSSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGC
NPVLIKRCTELPKKLPVTTEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDPC
THQFLAAPICLLYKNLANKIVPIAIQLNQTPGEKNPIFLPTDSKYDWLLAKIWVRSSDFH
IHQTITHLLRTHLVSEVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLNCEYGL
FDKANATGGGGHVQMVQRAVQDLTYSSLCFPEAIKARGMDNTEDIPYYFYRDDGLLVWEA
IQSFTTEVVSIYYEDDQVVEEDQELQDFVKDVYVYGMRGRKASGFPKSIKSREKLSEYLT
VVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWH
LGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMIRFRKNLEAIVSVIAERNKNKKLPYY
YLSPDRFQTV
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgccttcctacactgtcaccgtagccaccggtagccagtggttcgcgggcaccgacgac
tacatttacctcagcctcattggctctgcaggctgcagtgagaagcatcttcttgacaaa
gctttctacaatgacttcgagcgcggcggtcgcgactcctatgacgtcactgtggatgaa
gaactgggtgagatctacctagtcaaaatcgagaagcgcaaatacaggctccatgatgac
tggtacttgaaatacatcacactgaagacaccccacgactacatagagttcccttgttat
cgttggatcacaggcgagggcgagattgtcctgagggatggatgtgcaaaattggcccga
gatgaccaaatccacatcctcaagcagcacaggcggaaagaactggaaacacgtcagaaa
cagtatcgatggatggagtggaaccccggcttccctttgagtattgatgctaaatgccac
aaggatctgccccgagatatccagtttgatagtgaaaagggagtggactttgttctgaac
tactcaaaagcgatggagaacctgttcatcaatcgcttcatgcacatgttccagtcttcc
tggcatgactttgctgactttgagaaaatcttcgtcaaaatcagcaacactatttctgag
agagtcaagaaccactggcaagaggacctcatgtttggctaccagttcctgaatggctgc
aacccagtactcatcaagcgctgcacagagttgcctaagaagctcccagtgaccacagaa
atggtggagtgcagcctagagcggcagctcagtttagaacaggaagtacaggaagggaac
attttcatcgttgattacgaactactggatggcattgatgctaacaaaactgacccctgt
acacaccagttcctggccgcccccatctgcctgctgtataagaacctagccaacaagatt
gttcccatcgccatccagctcaaccaaacccctggagagaagaacccaattttcctccct
acggactcaaaatacgactggcttttggccaaaatctgggtgcgttcaagtgacttccat
atccatcaaacaatcacccatcttctccgcacacatctggtgtctgaggtgttcggtatt
gccatgtaccgccagctgcctgctgtgcacccccttttcaagctgctggtagcccatgtg
aggttcaccattgccatcaacactaaggcccgggaacagcttaactgtgagtacggcctt
tttgacaaggccaatgccaccggaggtggtgggcacgtgcagatggtgcagagagctgtc
caggacctgacctattcctccctgtgcttcccggaggccatcaaggcccggggcatggac
aacaccgaggacatcccctactacttctatcgtgatgatggactgctcgtgtgggaagct
atccagtcgttcacaactgaggtggtaagcatctactatgaggatgaccaggtggtggag
gaggaccaggaactgcaggacttcgtgaaggatgtttacgtttatggcatgcggggcaga
aaggcctcaggtttccccaagtccatcaagagcagggagaaattgtctgagtacctgacg
gtggtgatcttcacagcctcggcccagcatgcagctgtaaactttggccagtatgactgg
tgctcctggatccccaacgctcctccaactatgcgggccccaccacccacggccaagggt
gtggtcaccatcgagcagattgtggatactctaccagaccgtggccgctcatgttggcat
ctaggtgcagtgtgggccttgagccagtttcaagagaatgagctgtttctgggcatgtac
ccagaggagcatttcatcgagaagccagtgaaagaagccatgattcgattccgcaagaac
ctggaggccatcgtcagcgtgattgccgagcgcaataagaacaaaaagctcccctactac
tacctgtcaccagacagattccaaacagtgtag

DBGET integrated database retrieval system