KEGG   Rattus norvegicus (rat): 252902Help
Entry
252902            CDS       T01003                                 

Gene name
Dync1li1, Dncli1, Dnclic1
Definition
(RefSeq) dynein cytoplasmic 1 light intermediate chain 1
  KO
K10416  dynein light intermediate chain 1, cytosolic
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04962  Vasopressin-regulated water reabsorption
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    252902 (Dync1li1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    252902 (Dync1li1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    252902 (Dync1li1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    252902 (Dync1li1)
   03036 Chromosome and associated proteins [BR:rno03036]
    252902 (Dync1li1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    252902 (Dync1li1)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    252902 (Dync1li1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      252902 (Dync1li1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     252902 (Dync1li1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DLIC ABC_tran Roc AAA_16 RsgA_GTPase PduV-EutP G-alpha DUF815 TsaE
Motif
Other DBs
NCBI-GeneID: 252902
NCBI-ProteinID: NP_665715
RGD: 71072
Ensembl: ENSRNOG00000010434
UniProt: Q9QXU8
Position
8q32
AA seq 523 aa AA seqDB search
MAAVGRVGSFGSSPPGLASTYASGPLANELASGSGGPAAGDDEDGQNLWSRILREVSTRS
RSKLPTGKNVLLLGEDGAGKTSLIRRIQGIEEYKKGRGLEYLYLNVHDEDRDDQTRCNVW
ILDGDLYHKGLLKFSLDALSLRDTLVMLVVDMSKPWTALDSLQKWASVVREHVDKLKIPP
EEMKEMEQKLIRDFQEYVEPGEDFPASPQRRATAAQEDRDDSVVLPLGADTLTHNLGLPV
LVVCTKCDAISVLEKEHDYRDEHFDFIQSHIRKFCLQYGAALIYTSVKENKNIDLVYKYI
VQKLYGFPYKIPAVVVEKDAVFIPAGWDNDKKIGILHENFQTLKIEDNFEDIITKPPVRK
FVHEKEIMAEDDQVFLMKLQSLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVASV
SPIPAGSKKIDPNMKAGATSEGVLANFFNSLLSKKTGSPGGPGVGGSPGGGAAGASTSLP
PSAKKSGQKPVLSDVHAELDRITRKPASVSPTTPPSPTEGEAS
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtggggcgagtcggctcgttcggttcatctccacccgggctagcctcgact
tacgccagcggacccctagccaacgagctggcttcgggcagcggcggccccgcggcgggc
gacgatgaggacgggcagaacctttggtcccgcatcctcagggaagtctccacgcgctcg
cgctccaagctcccgaccgggaagaacgtgctgctgctgggtgaggatggagctgggaaa
acaagcctcataagaagaatccaggggatagaggagtacaagaagggacgaggactggag
tatttgtacttaaatgtgcatgacgaagacagggatgatcaaacaagatgtaatgtatgg
atcttagatggagatctataccacaaagggctactcaagttctctctggatgccctttct
ctgagggacactctggtcatgttggtcgtcgatatgtcaaagccttggactgctttggat
tccttacagaagtgggcaagtgtggtgagagaacatgttgacaaactgaaaatcccccct
gaagaaatgaaggaaatggagcagaagttgattagagacttccaagagtacgtggagcca
ggagaagacttcccagcctcccctcagcgaagagccacggctgcacaggaggacagagat
gacagtgtcgtcctacccctgggtgcagacacgctcacacacaacctgggcctacccgtg
ctcgtagtctgtacaaagtgtgatgccattagtgtcttggagaaagaacatgactataga
gatgaacacttcgattttatccagtcacacatccgcaagttctgtttacagtatggtgca
gcgctgatttacacgtctgtcaaagagaacaagaacatagatttagtttataaatacatc
gtccagaagctgtacgggttcccctacaagatccctgcggtggtggtggaaaaggacgca
gtgttcattccagcagggtgggataatgataagaaaataggaatattacatgaaaatttt
caaactttgaaaatagaagataattttgaagacatcataaccaaacctcctgtccgaaag
tttgtgcatgagaaggagattatggcagaagatgaccaagtgtttcttatgaagctacag
tctcttttagcaaagcaacctccaactgctgctggaaggcctgtggatgcatcaccaaga
gtccctggaggctctcctcgaacaccaaacagatccgtgtcatccaatgttgccagcgtg
tcccccatccctgcaggatccaaaaaaattgatcccaacatgaaagctggagcaaccagc
gaaggggtcctggcaaatttcttcaacagtctgttgagtaagaagactggctctcctgga
ggccccggggtcgggggcagtcctggaggaggggctgcaggtgcaagcacgagtttgcca
ccatccgccaagaagtcaggccagaaacctgtgctctcagatgttcatgccgagctcgac
agaatcacacggaaacctgcttctgtttctcctacaacacctccatctcctacggaagga
gaagcctcctga

DBGET integrated database retrieval system