KEGG   Rattus norvegicus (rat): 25291Help
Entry
25291             CDS       T01003                                 

Gene name
Anxa3, Anx3, LC3, LRRGT00047
Definition
(RefSeq) annexin A3
  KO
K17089  annexin A3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25291 (Anxa3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   25291 (Anxa3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin PilJ
Motif
Other DBs
NCBI-GeneID: 25291
NCBI-ProteinID: NP_036955
RGD: 2119
Ensembl: ENSRNOG00000002045
UniProt: P14669
Position
14p22
AA seq 324 aa AA seqDB search
MAASLWVGPRGTINNYPGFNPSVDAEAIRKAIKGIGTDEKTLINILTERSNAQRQLIVKQ
YQEAYEQALKADLKGDLSGHFEHVMVALITAPAVFDAKQLKKSMRGMGTDEDTLIEILTT
RTSRQMKEISQAYYTAYKKNLRDDISSETSGDFRKALLTLADGGRDESLKVDEHLAKKDA
QTLYDAGEKKWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIEDSIKGELSGHFEDL
LLAVVRCTRNTPAFLAGRLHQALKGAGTDEFTLNRIMVSRSEIDLLDIRREFKKHYGCSL
YSAIQSDTSGDYRTVLLKICGGDD
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtctttgtgggttggacctcgagggaccataaacaattatccaggctttaac
ccatcagtggatgccgaagctatccggaaagcaatcaaaggaattggaactgacgagaaa
actctcatcaacattctgacggagcggtcgaacgcacagcggcagctgattgtcaagcag
tatcaagaggcatatgaacaggcgctgaaagctgacttgaagggtgatctctctggccac
tttgagcatgtcatggtggctcttattactgcaccggccgtgtttgatgccaagcaactg
aagaaatccatgaggggcatgggcacagatgaagacaccctgattgaaatcttaacaacc
aggacaagcaggcagatgaaggagatctcgcaggcctattatacagcatataagaagaat
ctcagagatgacattagctctgaaacgtctggagacttccggaaagctctgctgactttg
gcagatggtggaagagacgaaagcctgaaagtggatgaacatctggccaaaaaagatgcc
cagaccctctacgatgctggtgagaaaaaatggggcacggatgaagacaaattcaccgag
atcctgtgtctacggagctttccgcagctgaaactgacatttgatgagtacagaaacatt
agtcagaaggacattgaggacagcattaaaggagaattatctgggcattttgaagacctg
ctgctggccgtagttcgctgtacgaggaacaccccagcttttttggcaggaagacttcat
caggctttgaagggagctggaacagatgaattcactctgaacagaataatggtctccaga
tcagagattgaccttctggacatccgacgtgagttcaagaagcactacggctgctcttta
tactcagccatccaatcagatacttctggagactacagaactgtgctgttgaagatctgt
ggaggagatgattga

DBGET integrated database retrieval system