KEGG   Rattus norvegicus (rat): 252915Help
Entry
252915            CDS       T01003                                 

Gene name
Mxd3, Mad3, Myx
Definition
(RefSeq) Max dimerization protein 3
  KO
K09114  MAX dimerization protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    252915 (Mxd3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    252915 (Mxd3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH MSP1_C ParD_antitoxin DUF4407 Exonuc_VII_L T3SS_needle_E Spc7
Motif
Other DBs
NCBI-GeneID: 252915
NCBI-ProteinID: NP_665716
RGD: 628624
Ensembl: ENSRNOG00000016539
UniProt: Q62912
Position
17p14
AA seq 206 aa AA seqDB search
MEPVASNIQVLLQAAEFLERREREAEHGYASLCPHHSPGTVCRRRKAPLQAPGALNSGRH
VHNELEKRRRAQLKRCLEQLRQQMPLGVDHTRYTTLSLLRGARMHIQKLEEQEQQAQRLK
EKLRSRQQSLQQQLEQLQGLLGVRERDRLRADSLDSSGLSSERFDSDQEDLEVDVESLVF
GTETELLQSFSAGQEHSYSHSTGTWL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggaacccgtggctagcaacatccaggtcctgctgcaggcagcggagttcctggagagg
cgcgagagagaggcggagcacggttatgcgtccctgtgtccacaccacagtcccgggacc
gtatgcaggaggaggaaggcacccctgcaagctcctggcgcgctcaacagtgggcggcat
gtgcacaatgagctggagaaacggaggagagcccagctgaagcggtgcttagagcaactg
aggcagcagatgcccttgggagttgaccatacccgatatactacactgagcctgctgcgc
ggagccaggatgcacatccagaagctggaggagcaggagcagcaggcccagcggctcaag
gagaagcttcggagcagacagcagagcctgcagcagcagttggagcagctccaggggctg
ctgggagtgagagagcgggaccggctgagagctgacagcctcgattcttcaggcctgtcc
tctgagcgctttgactcggaccaagaggatctggaggtggatgtggaaagcctggtgttt
gggactgagacggagctcctacagagcttcagcgctgggcaggagcacagctactcacac
agcactggcacctggctatga

DBGET integrated database retrieval system