KEGG   Rattus norvegicus (rat): 252917
Entry
252917            CDS       T01003                                 

Gene name
Nr1d1
Definition
(RefSeq) nuclear receptor subfamily 1 group D member 1 isoform 1
  KO
K03728  nuclear receptor subfamily 1 group D member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    252917 (Nr1d1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    252917 (Nr1d1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    252917 (Nr1d1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    252917 (Nr1d1)
Nuclear receptors [BR:rno03310]
 1. Thyroid hormone like
  1D. Rev-Erb
   252917 (Nr1d1)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 252917
NCBI-ProteinID: NP_001106893
RGD: 628827
Ensembl: ENSRNOG00000009329
UniProt: Q63503
Position
10
AA seq 614 aa
MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDSSNGSFQSLTQGCPTYFPPSPTGSL
TQDPARSFGTVPPSLSDDSSPSSASSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKGTS
NITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRI
NRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQNAMNLANNQLSSLCPLETS
PAPHPTSGSVGPSPPPAPAPTPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIF
TYAHDKLGTSPGNFNANHASGSPPATTPQCWESQGCPSTPNDNNLLAAQRHNEALNGLRQ
GPSSYPPTWPSGPAHHSCHQPNSNGHRLCPTHVYSAPEGKAPANGLRQGNTKNVLLACPM
NMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVL
MVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLNAMFDFSEKLNSLALTEEELGLF
TAVVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPSETSRFTKLLLKLPDLRTLNN
MHSEKLLSFRVDAQ
NT seq 1845 nt   +upstreamnt  +downstreamnt
atgacgaccctagactccaacaacaacacaggtggtgttatcacctacattggctccagc
ggatcctcccccagccggaccagcccagagtccctctatagtgacagctccaatggcagc
ttccagtccctgactcaaggttgtcccacatacttcccaccatcacctactggctccctc
acccaggaccctgcccgctcatttggcactgtgccacccagcctcagtgatgatagctcc
ccttcttctgcttcatcatcatcatcatcttcctcctccttctataatgggagccccccc
ggaagtctacaagtggccatggaagacagcagccgagtgtcccccagcaagggcaccagc
aacattaccaagcttaacggcatggtgctactgtgtaaagtgtgtggggacgtggcctca
ggcttccactatggcgtgcatgcctgcgagggctgcaagggctttttccgccggagcatc
cagcagaacatccagtacaagcggtgtttgaaaaacgagaactgctccattgtccgtatc
aatcgcaaccgctgccagcagtgtcgcttcaagaagtgtctctccgttggcatgtctaga
gacgctgtgcgttttggacgtatccccaagagagagaagcaacgaatgcttgctgagatg
cagaacgccatgaacttggccaacaaccaactgagcagcctgtgccctctagagacctca
cctgccccgcaccccacctcaggctccgtgggcccctcaccacctcctgcaccagccccg
acacctttggtgggcttctctcagttcccacaacagctgacaccacccagatccccgagt
cctgagcccaccgtggaggatgtgatatcccaggtggccagggcccatcgagaaatcttc
acctatgcccatgacaaattaggcacctcacctggcaacttcaatgccaatcatgcatca
ggtagccctccggctaccactccacagtgctgggagagtcagggatgcccgtctaccccc
aacgacaacaaccttttggcggctcagcgtcataatgaagcactgaatggtctacgccag
ggcccctcctcctaccctcctacctggccttctggccctgcccaccacagctgccaccag
cctaacagcaatgggcatcgcctgtgccccacccacgtatactcggccccagaaggcaag
gcacctgccaacggtctacggcaaggcaacaccaagaatgttctgctggcatgtcccatg
aacatgtatccccatggacgtagtggccggactgtgcaggagatctgggaagacttctct
atgagcttcacacccgctgtgcgggaggtggtagaatttgccaaacacatccccggcttc
cgtgacctttctcagcacgaccaggtgaccctgcttaaggctggcacctttgaggtgctg
atggtgcgctttgcgtcattgttcaacgtgaaggaccagacagtcatgttcctgagccgc
acaacctacagcctgcaggagctcggtgccatgggcatgggtgacctgctcaatgccatg
tttgacttcagcgagaagctcaactctctggcgcttactgaggaggagctgggccttttc
acggcagtggtacttgtctctgcagaccgctcgggaatggagaattccgcttcggtggag
cagctccaggagacgctgctgcgggctcttcgggctctggtgctgaagaaccggccctcg
gagacttcccgcttcaccaaactgctgctcaagctgccggacctgcggaccctgaacaac
atgcattccgagaagctgctgtccttccgggtggacgcccagtga

DBGET integrated database retrieval system