KEGG   Rattus norvegicus (rat): 252918
Entry
252918            CDS       T01003                                 

Gene name
Spag5, Deepest
Definition
(RefSeq) sperm associated antigen 5
  KO
K21764  sperm-associated antigen 5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    252918 (Spag5)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    252918 (Spag5)
SSDB
Other DBs
NCBI-GeneID: 252918
NCBI-ProteinID: NP_001037689
RGD: 620152
Ensembl: ENSRNOG00000011777 ENSRNOG00000037214
UniProt: Q1ERY8
Position
10q25
AA seq 1187 aa
MWRVKTLNLGLSPSPQSGKPAMRTPLRELKLQPEALADSGKGPMFSSLTPYLRRLDLKER
RNSSSPVNFVNAENSSPVDFVNTENTSPVDFDNTENNFLSEQFSHPSEYIEACQRESDLT
PESSSPFNTLEKAVEAMDDFVAEPIDDGIVKTMVLLPFSLGQQQDLMLQAHLDTTAERNK
SSLKESLGLEDLVEKEAAPCVEDSLPETVAIRPEQPISQDPPLRDSNTEAAPAGSVPSEN
VLGFTVACLSPSTVLTKDFSVDHVDPGEETAENRVIQEVEKSFLALPEEAGLGDQALAVN
AEDVSSLYLSSSLVEMGPQEAPGPTAEDASRIPDLESETWMSPLAWLEKGVNTSVMLQSL
RQSLPFSKSVLQDAAVGNTPHSTYSVGTSFTPPVPLEVGTKDSTSETERLLLGCRPPDLA
ALSRHDLEENLLNALVLLEVLSHQLQAWKSQLTVPSRQAQDSSTQTDSSAAVVTKTPKHL
QDSKEIRQALLQARNVIHSWGLVSRDLMSLLHLSLTHVQDDRVTVSQESQRAETLVSSCS
RVLKKLRAKLQSLKTEWEEARHREEMALKGKDAAEAVLEAFRAHASQRISQLEQGITSVQ
EFRGLLQEAQTQLIGLHTEQEELAQHTVSLTSALQQDWTSVQQNYGTWAALLSRSRELTK
KLTAKSRQALQERDAAIEEKDQVVKEVEQVSAHLEDCKGQIEQLKLENSRLTADLSAQLQ
TLASTENELKELQSQHSHCVQDLAMKDELLCQLTQSNKEQAAQWQKEETELKHRQAELLQ
QKAVLAKEVQDLRETMEFVDEESQVAHLELGQIESQLKATLEVLRERSLQCETLKDTVES
LRAELASTEAKHEQQALEKTHQHSKELCLLAEQLQSLTLFLEAKLEENKAESDIILPSTG
CAPAQEHPPSSDSSVSEQIPTAVVDEVPEPAPVPLLGSVKSAFTRVASTAPFRPTETPAL
EKSLAEMSAVLQELQRLCALLQESKEEAVGVLQREICELHTRLQAQEEEHQEAQKAKEAD
IEKLNQALCLRHKNEKELLEVIQKQNEKILGQIDTSGQLINLREEVTQLTRLLRRAETET
KVLQEALEGQVDPSCQLMATNWIQEKVFLSQEVNKLRAMFLEVKNEKKQLMDKYLSHRHI
LEENLRRSDTELKKLDDTIQHIYETLLSIPEVVKSCKELQGLLEFLS
NT seq 3564 nt   +upstreamnt  +downstreamnt
atgtggagggtgaaaacactgaatctcggcttgtcgccttcgccccaatcggggaaacca
gctatgagaactcctctccgagagcttaaactacagcccgaggccctcgctgattcaggg
aaaggtcctatgttctcctcgctgaccccatacctgcgcaggctggatctgaaggaaagg
cgcaacagctcatctccagtgaattttgttaatgcagagaactcatctccagtggatttt
gtcaatactgagaacacatctccagtggattttgacaatactgagaacaacttcctttca
gaacagttcagccatccttcagagtacatagaagcttgtcagcgtgaatcagatctaact
cctgaaagcagctctcctttcaacacactggagaaggcagtggaagcaatggatgatttt
gtggcagaaccaatagatgacggtatagttaagaccatggttcttttacccttttcctta
gggcagcagcaagacctgatgctccaggctcacttagataccacagcagagagaaataaa
agctctctaaaagaatctttggggctagaagacctggtggaaaaggaggcggcaccttgt
gtggaagacagcttaccagaaactgttgctatcaggcctgagcaacccatctctcaggac
cctccattaagagacagtaacactgaagctgcacctgcgggctcagttccttctgaaaat
gtcttgggtttcactgtggcttgtctctctccctcaactgtcttgaccaaagatttctct
gtcgatcatgtcgatcctggggaggaaactgcagagaacagagttatacaggaagtggaa
aagagttttctcgcactccctgaggaggctggattgggagatcaggcacttgctgtaaat
gcagaagacgtctcatccttatacctgtcatcaagtctagtagaaatgggaccccaggag
gctccaggcccaacagcagaagatgccagtaggattcctgacttggagtcagagacttgg
atgtccccattggcctggctagaaaaaggtgtgaacacgtcagtcatgctacaaagtctc
cgccagagtttacccttttcaaaatctgtgcttcaggatgctgccgttggcaatacaccc
cactccacttattctgtgggaacttcctttactcctccagtgccactggaagtaggcacc
aaggacagtacttcagagacagagcgcctcctcttgggctgccgtcctccagatctggca
gccttgtcccggcacgacttggaagagaacctgttgaacgcccttgtcttgctggaagtt
ctttctcaccagctgcaagcctggaagagtcagctgactgtcccgagccggcaagctcaa
gacagcagcacacagaccgacagctctgcagctgtggtcactaagacacctaaacatctt
caggacagcaaggagattcgacaggctctactgcaagccaggaatgtcatacattcatgg
gggctagtctctagagacctgatgtccttgcttcacctgtccctgacacatgtgcaagat
gacagagtgacagtgagtcaggagtctcagcgtgcagagaccctggtttcctcctgttct
cgtgtactgaagaaattgagggcaaagctccagagcctcaaaacagaatgggaggaggca
cggcacagggaggaaatggcccttaaaggcaaggatgcggcagaggcagtactggaggct
ttccgtgcacacgctagccagcgcatcagccaactggaacagggtatcacatctgtgcag
gaattcagaggccttctacaggaggcacagacccaactgatagggcttcacacagagcaa
gaagagctggctcagcacacagtgagtctgacttctgccttgcagcaggactggacatca
gtccaacagaattatgggacatgggcagctttgctgagtcggtctcgagaactcaccaag
aaactcacagccaagagccggcaagcccttcaggaacgtgatgctgcaattgaggaaaag
gatcaggttgtgaaggaagtggaacaagtctctgcccatttagaggactgtaaaggccaa
atagaacaactgaagttggaaaatagtcgccttactgcagatctctcggctcagctgcag
actctggctagcacagagaacgaactaaaggaactacagagtcagcattcccattgtgtc
caagacttggccatgaaggatgaactgctgtgtcaacttacccagagcaacaaggaacag
gctgctcagtggcaaaaggaagaaacggaactgaaacacagacaagcagaactgctgcag
cagaaggctgtgttggctaaggaggtacaggacctgagggagaccatggagtttgtagat
gaagagagtcaagttgctcacctggagctgggccagatcgagagtcagttgaaagccaca
ctagaagttctgcgggagcgcagcctgcagtgtgagaccctcaaggacaccgtggagagc
ctgagggcagagctggccagcaccgaagcaaagcatgagcaacaagcgctggagaagacg
caccagcattctaaagagctgtgtctattggcggagcagctacagagtctcaccctcttc
ttagaggctaaactagaggagaacaaggcagaatcagacatcattctgcccagcacaggc
tgtgctccagcccaggaacaccctccttccagtgatagcagcgtctcagaacagatcccg
acagcagtggtagatgaagtgccagaaccagctcctgtgccattgcttggaagtgttaag
agtgctttcacccgcgtagcctcaacagctccctttcggcctacagagaccccagccctg
gagaagagcctggcagaaatgagtgctgtgttacaggagcttcaacgcctctgtgccctg
ctgcaagaatctaaagaggaagccgttggtgtcctgcagagggaaatctgtgaactgcac
acaagactacaggcccaagaagaagaacatcaggaagcccaaaaggcaaaggaagcagac
atagagaagttgaaccaggccttgtgcttgcgccacaagaatgagaaggaactcctggaa
gtgatacagaagcagaacgaaaagatcctggggcagatagacacgagtggccagctcata
aacctcagggaggaggtgacccagcttacacgtttacttcggcgggcagagacagagact
aaagtgctccaggaagccctggaaggccaggtagatcccagctgtcagctgatggctact
aactggatccaggaaaaagtgtttctctcgcaggaggtgaacaaactgagggctatgttc
ctggaggtgaaaaatgagaagaaacagctgatggacaagtatctgagccataggcacatc
ctggaggagaatcttcggcgctctgacacagagttaaagaaacttgatgacacaattcag
catatctatgagactctgttgtctatcccagaggtagtgaagagttgcaaggagctacaa
ggattgctagaatttctgagctaa

DBGET integrated database retrieval system