KEGG   Rattus norvegicus (rat): 252921Help
Entry
252921            CDS       T01003                                 

Gene name
Tubg1
Definition
(RefSeq) tubulin, gamma 1
  KO
K10389  tubulin gamma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    252921 (Tubg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    252921 (Tubg1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    252921 (Tubg1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    gamma-tubulin ring complex
     252921 (Tubg1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    252921 (Tubg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Motif
Other DBs
NCBI-GeneID: 252921
NCBI-ProteinID: NP_665721
RGD: 628606
Ensembl: ENSRNOG00000020213
UniProt: P83888
Position
10q31
AA seq 451 aa AA seqDB search
MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHY
IPRAVLLDLEPRVIHSILNSSYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFD
IIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSD
VVVQPYNSLLTLKRLTQNADCVVVLDNTALNLIATDRLHIQNPSFSQINQLVSTIMSAST
TTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQP
KNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVAL
SRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQFDKLRKREAFMEQFRKEDIFKDNFDE
MDTSREIVQQLIDEYHAATRPDYISWGTQEQ
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgccgagagaaatcatcaccctacagttgggccagtgcggcaatcagattgggttcgag
ttctggaaacagctatgtgctgagcatggcatcagccccgagggcatcgtagaggagttc
gccaccgagggcactgaccgcaaggacgtctttttctaccaggcagacgatgagcattac
atcccccgggctgtgctgctggacctggagccccgggtgatccattccatcctcaactcc
tcctatgccaagctctacaacccagagaacatctacctgtccgagcatggaggaggggct
ggcaacaactgggccagcggattctcccagggagaaaaaatccacgaggacatttttgac
atcattgatcgggaggcagatggcagtgacagcctagagggatttgtactgtgtcactcc
attgctggggggacaggctctggcttgggctcctacctcttggaacggctaaatgacagg
taccccaaaaaactagtgcagacgtactccgtgttccccaaccaggacgagatgagtgac
gtggtggtccagccctacaactccctcctcacgttaaagaggctgacccagaacgcggac
tgtgtggtggtgctggacaacacggccctgaacctgatcgccacagaccgcctgcacatc
cagaacccatccttctcccagatcaaccagctggtgtccaccatcatgtcagccagcacc
accaccctgcgctaccccggatacatgaacaacgacctcatcggcctcatcgcctcactc
attcccacccctcgactacacttcctcatgactggctatacccccctcaccacggaccag
tcagtggccagtgtgaggaagacaacagtcctggatgtcatgaggagactgctacagccc
aagaacgtgatggtgtccacaggtcgggatcgtcagaccaaccactgctacatcgccatc
ctcaacatcatccagggagaggtggaccccacccaggtccacaagagcctgcagaggatc
cgggagaggaagttggccaactttatcccctggggcccggccagcatccaggtggccctg
tcaaggaagtctccctacctgccctcagcccaccgggtcagcgggctcatgatggccaac
cacaccagtatctcctcgctttttgaaaggacctgtcgccagtttgacaagctgaggaaa
cgggaggccttcatggagcagttccgcaaggaggacatcttcaaggacaattttgacgag
atggacacctccagggagattgtgcagcagctgattgacgagtaccatgcggccacacgg
ccagactacatctcctggggcacccaggagcaatga

DBGET integrated database retrieval system