KEGG   Rattus norvegicus (rat): 252924Help
Entry
252924            CDS       T01003                                 

Gene name
Nr2c1, Psg4, TR2-11, Tr2
Definition
(RefSeq) nuclear receptor subfamily 2, group C, member 1
  KO
K08543  testicular receptor 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    252924 (Nr2c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    252924 (Nr2c1)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    252924 (Nr2c1)
Nuclear receptors [BR:rno03310]
 2. Hepatocyte nuclear factor 4 like
  2C. Testicular receptor
   252924 (Nr2c1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4 DUF2318
Motif
Other DBs
NCBI-GeneID: 252924
NCBI-ProteinID: NP_665723
RGD: 3200
Ensembl: ENSRNOG00000006983
UniProt: Q8VIJ4
Position
7q13
AA seq 590 aa AA seqDB search
MATIEEIAHQIIDQQMGEIVTEQQTGQKIQIVTALDHSTQGKQFILANHEGSTPGKVFLT
TPDAAGVNQLFFASPDLSTPHLQLLTENSPDQGPNKVFDLCVVCGDKASGRHYGAITCEG
CKGFFKRSIRKNLVYSCRGSKDCIINKHHRNRCQYCRLQRCIAFGMKQDSVQCERKPIEV
SREKSSNCAASTEKIYIRKDLRSPLAATPTFVTDSETARSTGLLDSGMFVNIHPSGIKTE
PALLMTPDKAESCQGDLGTLASVVTSLANLGKAKDLSHCGGDLPVVQSLRNGDTSFGAFH
QDIQTNGDVSRAFDNLAKALTPGENPACQSPGESMEGSTHLIAGEPSCMEREGPLLSDSH
VVFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALGQENSISLVKAYWNEL
FTLGLAQCWQVMNVATILATFVNCLHNSLQQDKMSPERRKLLMEHIFKLQEFCNSMVKLC
IDGHEYAYLKAIVLFSPDHPGLENMELIEKFQEKAYVEFQDYITRTYPDDTYRLSRLLLR
LPALRLMNATITEELFFKGLIGNVRIDSVIPHILKMEPADYNSQIIGHSL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccatagaagaaattgcacatcagattattgaccaacagatgggtgagattgtt
acagagcagcagactggacagaaaatccagatcgtgacagcacttgaccacagcacacag
ggcaagcagttcattctagcaaaccatgagggatccaccccagggaaagtcttcctcacg
acaccagatgctgcaggtgtcaaccagttgttttttgccagtcctgatctgtccacacca
cacctccagctcttaacagaaaattctcctgaccagggaccaaataaggtctttgacctt
tgcgttgtgtgtggagacaaagcatcaggccgccattacggagcaataacttgtgagggc
tgcaaagggttttttaaaagaagcatccggaagaatctagtgtactcgtgccgggggtcc
aaagactgcatcattaacaagcaccaccggaaccgctgccaatactgccggctgcagcgg
tgcatagccttcgggatgaagcaagactccgttcagtgtgaaagaaagcccattgaagtg
tcccgagaaaagtcttccaactgtgcagcttctacagagaaaatctacatccgcaaagac
ctccgaagccctctggctgcaacgccaacctttgtaacggacagcgagactgccaggtca
actggactgttggattcggggatgtttgtgaatattcatccatctggaataaagacagaa
ccagctctgctaatgacaccagataaggctgagtcctgtcagggagacttgggcacattg
gccagtgtggtcacgtcattagcgaatctcggcaaggctaaagacctttctcactgtggt
ggcgatctgcctgtggtgcagagcttgcgcaatggagatacatcctttggtgcatttcat
caggatatccagaccaatggtgatgtgtcaagggcatttgacaatcttgcaaaagcattg
actcccggagaaaacccagcctgccagagcccaggagagagcatggaaggaagcacacat
ctaatcgctggagagccaagctgcatggagagagaggggccactgctcagcgattcgcat
gtcgttttcaggctcaccatgccttctcctatgcccgagtacctgaatgtgcactacatt
ggggagtcggcctccagactgctgttcttatcgatgcactgggcgctttccataccttct
ttccaggcgctcgggcaagaaaacagcatatcactggtaaaagcctattggaatgaactc
tttaccctcggtctcgcccagtgctggcaagtgatgaacgtcgcaactatattagcaacg
tttgtcaactgtcttcacaatagccttcagcaagataaaatgtccccggagaggaggaag
ttgttgatggagcacatcttcaagctgcaggagttctgtaatagcatggtgaagctctgc
atagacgggcatgagtacgcctacctcaaggccatcgttctcttcagtcccgaccatcca
ggcctggagaacatggagctgattgagaaatttcaggaaaaggcctatgtggaattccaa
gattacatcaccaggacatatccagatgacacctacaggctgtctagattacttctcaga
ctgccggccttgcggctgatgaatgccaccatcactgaggaattgttcttcaaaggtctc
attggcaacgtacggatcgacagtgtcatcccacacattttaaaaatggagcctgcagat
tacaactctcaaataattggtcacagcctttga

DBGET integrated database retrieval system