KEGG   Rattus norvegicus (rat): 25293Help
Entry
25293             CDS       T01003                                 

Gene name
Aqp4, AQP-4, Miwc, WCH4
Definition
(RefSeq) aquaporin 4
  KO
K09866  aquaporin-4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04962  Vasopressin-regulated water reabsorption
rno04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    25293 (Aqp4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    25293 (Aqp4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25293 (Aqp4)
Transporters [BR:rno02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    25293 (Aqp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-GeneID: 25293
NCBI-ProteinID: NP_036957
RGD: 2143
Ensembl: ENSRNOG00000016043
UniProt: P47863
Structure
PDB: 

Position
18p13
AA seq 323 aa AA seqDB search
MSDGAAARRWGKCGPPCSRESIMVAFKGVWTQAFWKAVTAEFLAMLIFVLLSVGSTINWG
GSENPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIT
AQCLGAIIGAGILYLVTPPSVVGGLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASCDS
KRTDVTGSVALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIG
AVLAGALYEYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVH
VIDIDRGDEKKGKDSSGEVLSSV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacggagctgcagcgaggcggtggggtaagtgtggacctccctgcagcagagag
agcatcatggtggctttcaaaggcgtctggactcaagccttctggaaggcggtcacagca
gagttcctggccatgctcatctttgttctgctcagcgtgggatccaccattaactggggt
ggctcagagaaccccctacctgtggacatggtcctcatctccctctgctttggactcagc
attgccaccatggttcagtgcttcggccacatcagcggtggccacatcaacccagcggtg
acagtggccatggtgtgcacacgaaagatcagcatcgccaagtccgtcttctacatcact
gcgcagtgcctgggggccatcatcggagctgggatcctctacctggtcacaccccccagc
gtggtgggaggattgggagtcaccacggttcatggaaacctcactgctggccatgggctc
ctggtggagctaataatcactttccagctggtattcaccatttttgccagctgtgattcc
aaacggactgatgttactggttccgttgctttagcaattgggttttccgttgcaattgga
catttgtttgcaatcaattataccggagccagcatgaatccagctcgatcctttggccct
gcagttatcatgggaaactgggaaaaccactggatatattgggttggaccaatcataggc
gctgtgctggcaggtgcactttacgagtatgtcttctgtcctgacgtggagctcaaacgt
cgcctaaaggaagccttcagcaaagctgcacagcagacgaaagggagctacatggaggtg
gaggacaaccggagccaagtggagacagaagacttgatcctgaagcccggggtggtgcat
gtgatcgacattgaccgtggagacgagaagaaggggaaggactcgtctggagaggtatta
tcttctgtatga

DBGET integrated database retrieval system